Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A026W6P3

dbSWEET id: dbswt_997

Accession:   A0A026W6P3

Uniprot status:   Unreviewed

Organism:   Cerapachys biroi

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Hymenoptera ⇒ Apocrita ⇒ Aculeata ⇒ Vespoidea ⇒ Formicidae ⇒ Cerapachyinae ⇒ Cerapachyini ⇒ Cerapachys.

Sequence Information back to top


Sequence length:   217

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QVLV           CVV:   448       CHI:   8.7

Fasta sequence:

>tr|A0A026W6P3|A0A026W6P3_CERBI|Unreviewed|Cerapachys_biroi|217
MDTYKETVGFFAMIITMMQMLAGTLICKDIYKKGTTEGTDSMPFIGATAVCTLMLRYALM
LNDSAMINVNIFGLITSIIYMLVFYYYAPDTEKLFKQMIKVAGFVVIFLAYAEVESSEKI
EYRFGMLVTILLLLLIASPLVHLREVIETKNADILPIPIIVSGTLVSFMWLWYGYIIDNT
FLVFQNVIGLSLNVVQLSLFAMYGSKKSQDGLSSKQD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   205

Alignment file: A0A026W6P3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A026W6P3_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.7% favored    7.5% allowed    2.7% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A026W6P3_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    8.1% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A026W6P3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    6.5% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   105282561     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur