Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A023GJE5
dbSWEET id: dbswt_996
Accession: A0A023GJE5
Uniprot status: Unreviewed
Organism: Amblyomma triste
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Chelicerata ⇒ Arachnida ⇒ Acari ⇒ Parasitiformes ⇒ Ixodida ⇒ Ixodoidea ⇒ Ixodidae ⇒ Amblyomminae ⇒ Amblyomma.
Sequence Information back to top
Sequence length: 214
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: NAFV CVV: 403 CHI: 5.3
Fasta sequence:
>tr|A0A023GJE5|A0A023GJE5_9ACAR|Unreviewed|Amblyomma_triste|214
MDSEETIKALVGDLALVFTIVNYASGVQICRKVREKGGTHDFSPLPFLAGILATFLWLEY
GLMKEDRILIWVNSIGLLLQASFLGYFYSYTKVKGTLNWKIFVLLTVLAGVYYEVTYFIH
NKDVALSILGLMGCIAAFLFFASPLSSLLHVVRTQSVETLPFPLIVSAFIVSCLWTLYGI
ICEDAFIYTPNVMGALITACQLALFVIYPSGKRV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A023GJE5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A023GJE5_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 7.5% allowed .0% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A023GJE5_outward.pdb
Procheck score ⇒ Ramachandran plot: 88.8% favored 9.1% allowed .0% week 2.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A023GJE5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.3% favored 8.0% allowed 1.6% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA