| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A023FJE9
dbSWEET id: dbswt_995
Accession: A0A023FJE9
Uniprot status: Unreviewed
Organism: Amblyomma cajennense
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Chelicerata ⇒ Arachnida ⇒ Acari ⇒ Parasitiformes ⇒ Ixodida ⇒ Ixodoidea ⇒ Ixodidae ⇒ Amblyomminae ⇒ Amblyomma.
Sequence Information back to top
Sequence length: 214
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: NAFV CVV: 403 CHI: 5.3
Fasta sequence:
>tr|A0A023FJE9|A0A023FJE9_9ACAR|Unreviewed|Amblyomma_cajennense|214
MDSKETIKTIVGDLALVFTIVNYASGVQICRKVREKGGTHELSPLPFLAGILATFLWLEY
GLMKEDHILIWVNSIGLLLQASFLGYFYSYTKIKGSLNWKIFVLLMVLAGVYYEVTYFIN
NKDVALSIVGLMGCIAAFLFFASPLSSLLHVVRTQSVETLPFPLIVSAFIVSSLWTLYGF
ICEDAFIYTPNIMGALITACQLALFVIYPSGKHA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A023FJE9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A023FJE9_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 5.3% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A023FJE9_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.5% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A023FJE9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.9% favored 5.9% allowed 2.7% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA