Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A023F841
dbSWEET id: dbswt_994
Accession: A0A023F841
Uniprot status: Unreviewed
Organism: Triatoma infestans
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Euhemiptera ⇒ Heteroptera ⇒ Panheteroptera ⇒ Cimicomorpha ⇒ Reduviidae ⇒ Triatominae ⇒ Triatoma.
Sequence Information back to top
Sequence length: 214
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: QILV CVV: 467 CHI: 9
Fasta sequence:
>tr|A0A023F841|A0A023F841_TRIIF|Unreviewed|Triatoma_infestans|214
MGLEDYREVVGAAAGFATIAQCFSPLIICRDIIQQKDTNNVDPTPFIGGIGISLLMLQHG
LILNDPAMIPVNIIGLVLNIIYLSIFYSYTKDKFNVFTSLGKVIAGVAVLITYAQLESKE
RIEFNFGIIVTVLLLTLIAAPLFNLKEILRSKDTSSLPFPLISCGTVVTFLWLLYGIIIX
XXXIQIQNVVGCTLCCIQLALCLMYPGKPRKKVE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 207
Alignment file: A0A023F841.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A023F841_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.4% favored 7.3% allowed .6% week 1.7% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A023F841_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 3.9% allowed 1.1% week 1.7% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A023F841_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.9% favored 8.4% allowed 1.1% week .6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5