Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A023EMS5

dbSWEET id: dbswt_992

Accession:   A0A023EMS5

Uniprot status:   Unreviewed

Organism:   Aedes albopictus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Aedini ⇒ Aedes ⇒ Stegomyia.

Sequence Information back to top


Sequence length:   231

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   QFLV           CVV:   478       CHI:   7.3

Fasta sequence:

>tr|A0A023EMS5|A0A023EMS5_AEDAL|Unreviewed|Aedes_albopictus|231
MESLAVALQPYKDTVGLSAAVITVLQFFSGVFVVNDIRRKGSSEGFSAGPFLGGAVFSLL
NVQFGQMLQDDAMIKVNLIGLGLNVVYVCAFYWYTLGPAKNKVWGQIGLAGAIAAGLLAY
VQYEDPKVVEFRFGMILTVILLILVGMPLLGLGEILKNKSTEGLPFPIILSGSFVSLAWL
LYGVILRSNFLVAQNVIALALGLVQLSLFVIFPSKPSSSTKKATKSDKKTN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   214

Alignment file: A0A023EMS5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A023EMS5_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    7.9% allowed    .0% week    .6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A023EMS5_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.6% allowed    1.1% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A023EMS5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 88.1% favored    9.0% allowed    2.3% week    .6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur