Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A023EKI3

dbSWEET id: dbswt_991

Accession:   A0A023EKI3

Uniprot status:   Unreviewed

Organism:   Aedes albopictus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Aedini ⇒ Aedes ⇒ Stegomyia.

Sequence Information back to top


Sequence length:   232

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QSFV           CVV:   427       CHI:   2.7

Fasta sequence:

>tr|A0A023EKI3|A0A023EKI3_AEDAL|Unreviewed|Aedes_albopictus|232
MAPFDYLSMKDMLASSATISTVLQFLTGSVICHRYIRKKSTGETSAFPFVSGFLSCSLWL
KYGLLSEEHTIIFVNTIGSALFFAYVIIYFTFSVNKRTVVRQFLAVCCFILACSVYTKYE
SDSEVALRVIGLICCGVGVLFFASPLTVLAQVIRTKNTESLPFPIIVSSFFVSLQWFVYG
MLIEDSFIQIPNLLGCILSSIQLLLYAIYPNRKLYSDGGPSYQPLRSDANVL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   211

Alignment file: A0A023EKI3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A023EKI3_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    5.8% allowed    1.0% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A023EKI3_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    6.3% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A023EKI3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    6.3% allowed    .5% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur