Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A023EK24

dbSWEET id: dbswt_990

Accession:   A0A023EK24

Uniprot status:   Unreviewed

Organism:   Aedes albopictus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Aedini ⇒ Aedes ⇒ Stegomyia.

Sequence Information back to top


Sequence length:   222

Substrate Binding Site:   TNWN           CVV:   457       CHI:   -0.9

Selectivity Filter:   QLLV           CVV:   467       CHI:   8.3

Fasta sequence:

>tr|A0A023EK24|A0A023EK24_AEDAL|Unreviewed|Aedes_albopictus|222
MEALSQALQPYKELVGNVAGIVTVLQMFSGAFVCNDIRRKGSSDGFSPMPFIGGCGLTIL
FLQHALLMNDPAMINANVVGFAISVVYSTFFYLYTPRQSKGDFWKQLGMAGALTAAMIGY
AQIENPAVVEDRFGMIITVLMLMLIGQPLFGLPEIIRKKSTEGLPFAMILSGTVVGCMWL
LYGIILNNTFVILQNLAAVSLSGVQLALFVIYPSKDSKKKKQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   214

Alignment file: A0A023EK24.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A023EK24_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.3% favored    7.9% allowed    1.1% week    1.7% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A023EK24_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    6.8% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A023EK24_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    9.0% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur