| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A023BVW7
dbSWEET id: dbswt_1299
Accession: A0A023BVW7
Uniprot status: Unreviewed
Organism: Aquimarina atlantica
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Aquimarina.
Sequence Information back to top
Sequence length: 98
Substrate Binding Site: YLYL CVV: 530 CHI: 5
Selectivity Filter: IVIV CVV: 458 CHI: 17.4
Fasta sequence:
>tr|A0A023BVW7|A0A023BVW7_9FLAO|Unreviewed|Aquimarina atlantica|98
MNFLQSIPESIFEIIGFSIGFFVCIITAIQIIKEYKSKQSSSLSPGYVMGWLFVYSFWAL
YGLRFEAIALWTTNSLALFLQIGLCIIVFKKNKKNQHV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 13 Model end: 94 Inward Open: Template: 4X5M.pdb Model structure: A0A023BVW7_inward.pdb Alignment file: A0A023BVW7_inw.pir Procheck score ⇒ Ramachandran plot: 83.3% favored 14.6% allowed 2.1% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A023BVW7_outward.pdb Alignment file: A0A023BVW7_out.pir Procheck score ⇒ Ramachandran plot: 86.1% favored 10.4% allowed 1.4% week 2.1% disallowed Occluded: Model structure: A0A023BVW7_occluded.pdb Alignment file: A0A023BVW7_occ.pir Procheck score ⇒ Ramachandran plot: 91.7% favored 6.2% allowed 1.4% week .7% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA