Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A023BVW7

dbSWEET id: dbswt_1299

Accession:   A0A023BVW7

Uniprot status:   Unreviewed

Organism:   Aquimarina atlantica

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Aquimarina.

Sequence Information back to top


Sequence length:   98

Substrate Binding Site:   YLYL           CVV:   530       CHI:   5

Selectivity Filter:   IVIV           CVV:   458       CHI:   17.4

Fasta sequence:

>tr|A0A023BVW7|A0A023BVW7_9FLAO|Unreviewed|Aquimarina atlantica|98
MNFLQSIPESIFEIIGFSIGFFVCIITAIQIIKEYKSKQSSSLSPGYVMGWLFVYSFWAL
YGLRFEAIALWTTNSLALFLQIGLCIIVFKKNKKNQHV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   13     Model end:   94

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A023BVW7_inward.pdb    Alignment file: A0A023BVW7_inw.pir

Procheck score ⇒ Ramachandran plot: 83.3% favored    14.6% allowed    2.1% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A023BVW7_outward.pdb    Alignment file: A0A023BVW7_out.pir

Procheck score ⇒ Ramachandran plot: 86.1% favored    10.4% allowed    1.4% week    2.1% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A023BVW7_occluded.pdb    Alignment file: A0A023BVW7_occ.pir

Procheck score ⇒ Ramachandran plot: 91.7% favored    6.2% allowed    1.4% week    .7% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur