| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A022S447
dbSWEET id: dbswt_275
Accession: A0A022S447
Uniprot status: Unreviewed
Organism: Erythranthe guttata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Lamiales ⇒ Phrymaceae ⇒ Erythranthe.
Sequence Information back to top
Sequence length: 283
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVC CVV: 369 CHI: 10.1
Fasta sequence:
>tr|A0A022S447|A0A022S447_ERYGU|Unreviewed|Erythranthe_guttata|283
MATPMVATVFGVLGNIVSFLVYLSPMPTFYRIFKKKSTEGFQSIPYSVALFSAMLYLYYA
FLKTNVLILVTINSFGSVVEVGYLVTYLIYATKESRVFTTKLLMLFNVSSLGFIIAVTHF
LANGDTRLKIVGWICAAFSVSVFAAPLSIMRRVIQTKSVEFMPFTLSLFLTICAVVWFFY
GFLIHDFYIATPNIVGFVLGIAQMTLYVVYKNKNPKKNILPVEITKVHDLQTSTIIVEMK
AIDPQPQDRDSENPTVKHELELVVNVLDYGEQVPANIVVCPPV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 212
Alignment file: A0A022S447.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A022S447_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed .5% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A022S447_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.2% allowed 2.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A022S447_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22