| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A022RR92
dbSWEET id: dbswt_284
Accession: A0A022RR92
Uniprot status: Unreviewed
Organism: Erythranthe guttata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Lamiales ⇒ Phrymaceae ⇒ Erythranthe.
Sequence Information back to top
Sequence length: 233
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: YSVN CVV: 415 CHI: -1.4
Fasta sequence:
>tr|A0A022RR92|A0A022RR92_ERYGU|Unreviewed|Erythranthe_guttata|233
MALFNMENPLVLTFGILGNQFPTFKFALISHLVLHVHKKYTRSLMPTFYRILKKKSTEGF
QSVPYVVGLLSCMLWIYYATLKSNETLLITINSLGSFIEAIYIFIYISYAPKNAKILALE
LIMLLNVFGFGLILVLTHFLVKGSQRVHVLGWISVILSVSVYVAPLSIMKKVIQTKSVEF
MPISLSSALLLNAVMWFFYGLLLKDFYITVPNIVGFIFGVIQIILYLIYKKCK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 19 Model end: 231
Alignment file: A0A022RR92.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A022RR92_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.3% favored 4.1% allowed 1.0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A022RR92_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 4.1% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A022RR92_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 6.2% allowed .5% week 1.0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22