| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A022R2Q2
dbSWEET id: dbswt_264
Accession: A0A022R2Q2
Uniprot status: Unreviewed
Organism: Erythranthe guttata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Lamiales ⇒ Phrymaceae ⇒ Erythranthe.
Sequence Information back to top
Sequence length: 250
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVC CVV: 369 CHI: 10.1
Fasta sequence:
>tr|A0A022R2Q2|A0A022R2Q2_ERYGU|Unreviewed|Erythranthe_guttata|250
MASFTSKELAFIFGIIGNIISFLVFLAPVPTFYTIWKKKSSKSFQSIPYSVAFFSASLLL
YYGFLKTNAYMIVSINGIGCVIEAIYLVIYLIYAPNKAKIFTMKLIIVFNVGGLGLITGV
SLVAFKGVKRVSFVGWVCAIFTIAVFAAPLSIMRRVVRTKSVEFMPFTLSFFLTLCATTW
FFYGFFVRDYYIALPNVLGFLFGIAQMILYLIYKNAKKVDETKLEPPNKDIEKNTSSIEE
DAIEPESPSK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 215
Alignment file: A0A022R2Q2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A022R2Q2_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.3% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A022R2Q2_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.3% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A022R2Q2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 3.7% allowed 2.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA