Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A022QTU1
dbSWEET id: dbswt_263
Accession: A0A022QTU1
Uniprot status: Unreviewed
Organism: Erythranthe guttata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Lamiales ⇒ Phrymaceae ⇒ Erythranthe.
Sequence Information back to top
Sequence length: 246
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVC CVV: 369 CHI: 10.1
Fasta sequence:
>tr|A0A022QTU1|A0A022QTU1_ERYGU|Unreviewed|Erythranthe_guttata|246
MGSLSAKELEFIFGLLGNIISFLVFLSPLPTFYTIWKQKSSKGFQSIPYSVAFFSASLLL
YYAFLKTNAYMIVSINGIGCVIEAIYLLIYLMYAPKKSKIFTMRLIVFFNIGGLGLMTAV
SQLGFKGPKRVSFVGWVCAIVNIAVFAAPLSIMRQVIRTKSVEFMPFTLSFFLTLCAITW
FFYGFFVRDYYIAMPNVLGFLFGIAQMILYMIYKNAKKVGETNLDRELKQNRDVENNTSN
IIEEAI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 215
Alignment file: A0A022QTU1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A022QTU1_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 4.8% allowed 1.6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A022QTU1_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.4% favored 7.4% allowed .5% week 1.6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A022QTU1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 6.4% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 105964886 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA