| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A022QLK1
dbSWEET id: dbswt_679
Accession: A0A022QLK1
Uniprot status: Unreviewed
Organism: Erythranthe guttata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Lamiales ⇒ Phrymaceae ⇒ Erythranthe.
Sequence Information back to top
Sequence length: 235
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A022QLK1|A0A022QLK1_ERYGU|Unreviewed|Erythranthe_guttata|235
MSEGGLFSTYSLCSDAAGFAGNLFAFVLFVSPIPTFRRIVRNKSTEQFSGSPYIYGLLNC
LICLWYGLPIVCSGIIFVATVNSVGAVFQLVYIIIFVIYADKDKRLKMLGLVLAVFSVFA
VIVFVSIRVFEPPNRQLFVGYLSVFSLISMFASPLFIINLVIKTKSVEYMPFYLSLATLL
MSISFFAYGMLKKDPFIYVPNGIGAILGIVQLVLYFNYSRNSAEASRRPLLESYA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 7 Model end: 220
Alignment file: A0A022QLK1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A022QLK1_inward.pdb
Procheck score ⇒ Ramachandran plot: 96.8% favored 2.1% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A022QLK1_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A022QLK1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 4.3% allowed 1.6% week 1.1% disallowed
Gene Informationback to top
Gene ID: 105968453 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA