Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A022QLK1

dbSWEET id: dbswt_679

Accession:   A0A022QLK1

Uniprot status:   Unreviewed

Organism:   Erythranthe guttata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Lamiales ⇒ Phrymaceae ⇒ Erythranthe.

Sequence Information back to top


Sequence length:   235

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|A0A022QLK1|A0A022QLK1_ERYGU|Unreviewed|Erythranthe_guttata|235
MSEGGLFSTYSLCSDAAGFAGNLFAFVLFVSPIPTFRRIVRNKSTEQFSGSPYIYGLLNC
LICLWYGLPIVCSGIIFVATVNSVGAVFQLVYIIIFVIYADKDKRLKMLGLVLAVFSVFA
VIVFVSIRVFEPPNRQLFVGYLSVFSLISMFASPLFIINLVIKTKSVEYMPFYLSLATLL
MSISFFAYGMLKKDPFIYVPNGIGAILGIVQLVLYFNYSRNSAEASRRPLLESYA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   220

Alignment file: A0A022QLK1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A022QLK1_inward.pdb

Procheck score ⇒ Ramachandran plot: 96.8% favored    2.1% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A022QLK1_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.8% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A022QLK1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    4.3% allowed    1.6% week    1.1% disallowed

Gene Informationback to top


Gene ID:   105968453     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur