| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A022QBZ3
dbSWEET id: dbswt_145
Accession: A0A022QBZ3
Uniprot status: Unreviewed
Organism: Erythranthe guttata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Lamiales ⇒ Phrymaceae ⇒ Erythranthe.
Sequence Information back to top
Sequence length: 203
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: LSVN CVV: 398 CHI: 3.7
Fasta sequence:
>tr|A0A022QBZ3|A0A022QBZ3_ERYGU|Unreviewed|Erythranthe_guttata|203
MAIYNNKKILTFGILGTKFCYYLCLYTFRKIWREKSSGGHTFMPYLVAFFSSTLWVYYGL
LDRNGLIISINLFGCIIEIIYISIYYYYAPHNIRIKIAKITGLGLIVISVTIIVTYFTTH
GQFRSSIVGWVGTIFSVVVFAGPIKAVVDVFKTRNNTFVPIQLLGCLALNGLVWLAFGLA
SKDVVIVICNVVGFLVCLFQMIV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 204
Alignment file: A0A022QBZ3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A022QBZ3_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.3% favored 8.9% allowed 2.2% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A022QBZ3_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.4% favored 8.9% allowed 1.1% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A022QBZ3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 7.3% allowed 2.2% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA