Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A022Q3E2

dbSWEET id: dbswt_748

Accession:   A0A022Q3E2

Uniprot status:   Unreviewed

Organism:   Erythranthe guttata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Lamiales ⇒ Phrymaceae ⇒ Erythranthe.

Sequence Information back to top


Sequence length:   248

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNLN           CVV:   440       CHI:   0.6

Fasta sequence:

>tr|A0A022Q3E2|A0A022Q3E2_ERYGU|Unreviewed|Erythranthe_guttata|248
MENGIVLTIIDMENKVQTAVGIAGIISGVFLYLTPMKIVIRIAEERSSEKLSVTPYFLAY
LNCVFYMGYTAWSSNWLAVIANALDALIVFHYVMIFMFLSPINLIAYKRVGALLVVFVVL
VTFIFVPLSMHEHLGLLFNGLVATAFSIALYITSLFLVIQRKEVEFMSFYTSILMLLNGA
FWFVFGLLRQDFFIVLLNGVGCGVGAAQIYLMYPNNKGKTVKQKKTIEGETRNQKNKNKG
GENKTKIA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   217

Alignment file: A0A022Q3E2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A022Q3E2_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    8.0% allowed    2.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A022Q3E2_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.4% favored    7.0% allowed    2.7% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A022Q3E2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 88.2% favored    9.6% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Gene ID:   105973951     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR020846: MFS_dom. IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur