Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A016U6C9

dbSWEET id: dbswt_989

Accession:   A0A016U6C9

Uniprot status:   Unreviewed

Organism:   Ancylostoma ceylanicum

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Ancylostomatoidea ⇒ Ancylostomatidae ⇒ Ancylostomatinae ⇒ Ancylostoma.

Sequence Information back to top


Sequence length:   267

Substrate Binding Site:   GNWN           CVV:   412       CHI:   -0.6

Selectivity Filter:   LGNV           CVV:   373       CHI:   4.1

Fasta sequence:

>tr|A0A016U6C9|A0A016U6C9_9BILA|Unreviewed|Ancylostoma_ceylanicum|267
MSPYFFQINMDLQLFLQVLSCCAIITTIALFLCGIPICIEIMRRKGTKDISGVPFLMGLL
GGSFWLRYGFLKDDSTMIIVNLVGVSLFAIYCLFYLAFANPRCGFATKLTMVVSLIGAMA
AWVEYNANLNYLGIACMTFNILNFGSPLAGLGVVLRKRCCDTLPLPMCIANLLVSSQWFL
YGNIVRDAYIMVPNGIGMALAVFQLSLFVIFPRQENGKSVASHVVGLFSAREEDVEKGDV
TSTQTASTGISLVSGKKLMRKLSETLE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   9     Model end:   212

Alignment file: A0A016U6C9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A016U6C9_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.6% allowed    .0% week    1.7% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A016U6C9_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    7.3% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A016U6C9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    7.9% allowed    1.7% week    .6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur