Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_677297               3087 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN9120.2), mRNA.
ACCESSION   XM_677297 XM_413257
VERSION     XM_677297.1  GI:67904265
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 3087)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3087)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101410).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3087
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="IV"
     gene            1..3087
                     /locus_tag="AN9120.2"
                     /db_xref="GeneID:2868079"
     CDS             1..3087
                     /locus_tag="AN9120.2"
                     /note="similar to AF107793_1 DNA-dependent RNA polymerase
                     II RPB140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_682389.1"
                     /db_xref="GI:67904266"
                     /db_xref="GeneID:2868079"
                     /translation="MIAQERSAGNTVQVFKKAPPSPTPYVAEIRSAVEKGSRLLSQLS
                     LKLFGKGDSAKGGFGPTIRSTLPYIKADIPIVIVFRALGVVSDEDILNHICYDRNDTP
                     MLEMLKPCIEEGFVIQDREVALDFIAKRGSSQSSMNHERRVRYAREIMQKELLPHISQ
                     SEGSETRKAFFLGYMVHRLLQCALGRRDVDDRDHFGKKRLDLAGPLLANLFRVLFTRV
                     TRDLQRYVQRCVESDREIYLNVGLKASTVTQGLRYALATGNWGEQKKAASAKAGVSQV
                     LSRYTYASTLSHLRRTNTPIGRDGKIAKPRQLHNTHWGLVCPAETPEGQACGLVKNLA
                     LMCYITVGTPSEPIIDFMIQRNMEVLEEFEPQVTPNATKVFVNGVWVGVHRQPSHLVE
                     TMQALRRRNMISHEVSLIRDIREREFKIFTDAGRVCRPLFVVDNDPKSENCGNLVLNK
                     EHIRKLEEDKELPPDMDPEDRRERYFGWDGLVKSGVVEYVDAEEEETIMIVMTPEDLE
                     ISKQLQAGYALPEEQDPNKRVRSILSQRAHTWTHCEIHPSMILGVCASIIPFPDHNQS
                     PRNTYQSAMGKQAMGVFLTNFDQRMETMANILYYPQKPLATTRSMEFLRFRELPAGQN
                     AIVAIACYSGYNQEDSVIMNQSSIDRGLFRSLFYRTYSDSEKMVGLTVVERFEKPMRS
                     DTIGMRKGTYDKLDEDGIVNPGVRVSGEDIIIGKTAPLAPDAEELGQRTKNHTKLDVS
                     TPLRSTENGIVDQVLVTTTPDSLRSVKVRMRMTKVPQIGDKFASRHGQKGTIGITYRQ
                     EDMPFTREGVTPDLIINPHAIPSRMTIAHLIECQLSKVSALRGFEGDATPFTDVTVDS
                     ISRLLREHGYQSRGFEVMYNGHTGRKLVAQVFLGPTYYQRLRHMVDDKIHARARGPTQ
                     ILTRQPVEGRARDGGLRFGEMERDCMIAHGASAFLKERLFDVSDPFRVHICDDCGLMT
                     PIAKLKKGLFECRLCNNKHRISQVHIPYAAKLLFQELAAMNISARMFTNRSGVSVR"
ORIGIN      
        1 ttgatcgccc aggagcgcag tgctggaaat acagttcagg ttttcaagaa ggcgccgccc
       61 agtcccacac cctacgtcgc ggaaatccgc agtgcggtgg aaaagggctc aaggctgctc
      121 tcccagttat ctcttaagct atttggtaag ggtgacagtg ccaaaggggg ttttggccct
      181 actatcagat ccactctgcc gtacatcaag gccgatatcc cgatcgttat tgttttccgt
      241 gcgcttgggg tcgtttccga cgaggatatt cttaaccaca tctgttacga ccggaacgat
      301 acacctatgc tggagatgct gaagccctgt attgaagagg gttttgttat ccaggaccgt
      361 gaggtggcgt tggatttcat tgccaagcgt ggttcgtctc agtctagcat gaaccacgaa
      421 cgtcgtgtta gatatgctcg agagattatg cagaaggagc tgctgcctca tatctcccag
      481 agcgaaggca gtgaaactag aaaggctttc ttccttggtt acatggtgca cagacttctc
      541 cagtgcgctc ttggacgtcg cgatgttgac gatcgtgatc atttcggaaa gaagcgtctc
      601 gatcttgctg gtccgttgct agcaaacctt ttccgcgtcc tctttaccag agttacccgc
      661 gatctgcagc gttatgtgca gaggtgtgtg gagtccgacc gagagattta ccttaatgtt
      721 ggtctcaagg caagcaccgt tactcaaggt ctgcgctatg ccctcgctac tggtaactgg
      781 ggagagcaga agaaggcagc tagcgccaag gcgggtgtgt cgcaagtgct cagtcgctac
      841 acctacgctt caacattatc tcatcttcgg cgaacaaaca cgcctattgg tcgtgacggc
      901 aagattgcta aacctcgtca gctacacaac acgcattggg gtctggtatg tcctgcggaa
      961 acccctgaag gccaagcttg cggtctggtc aagaacttgg ctcttatgtg ctacattact
     1021 gttggtactc ctagcgaacc catcatcgat ttcatgattc agcgtaacat ggaagtgctt
     1081 gaggagtttg agcctcaggt aacaccgaac gccactaagg tctttgtcaa tggcgtctgg
     1141 gttggtgtcc accgtcagcc ttctcacctt gttgagacca tgcaagccct tcgtcggcga
     1201 aacatgattt ctcacgaagt cagtcttatt cgagacatcc gtgaacgaga attcaagatc
     1261 ttcaccgacg ccggtcgtgt atgccggcca ctcttcgtcg ttgacaacga tcccaagagt
     1321 gagaactgcg gcaacctagt cctcaacaag gagcacattc gcaagttgga agaagacaag
     1381 gaacttccac cggatatgga cccagaagac cgacgggagc gctactttgg atgggacggt
     1441 ctcgtcaaat ccggtgtcgt tgagtacgta gatgccgaag aggaggagac gatcatgatc
     1501 gttatgacgc ccgaggactt ggagatttca aagcagctgc aggctggtta cgcacttccg
     1561 gaagagcaag atccaaacaa gcgtgtgcgg tcgattctca gccagagggc gcacacctgg
     1621 acacactgcg agattcaccc cagtatgatt cttggtgtct gcgccagtat tatccccttc
     1681 ccagatcaca accagtctcc tcgtaacacc taccagtcag ctatgggtaa acaagctatg
     1741 ggtgtgttct tgaccaactt cgatcagcgc atggagacca tggcgaacat cctgtactac
     1801 ccgcagaagc cgctggcgac cacgcggtct atggagttct tgagattccg agaacttcct
     1861 gctggtcaga atgcgatcgt cgccattgct tgttactcag gttataacca agaagattca
     1921 gtcatcatga atcaaagcag tatcgatcgt ggtctattcc gcagtctttt ctaccgtaca
     1981 tactcagaca gcgagaagat ggtcggattg acagtggtcg agcggtttga gaagcccatg
     2041 cgttccgaca cgattggcat gcgcaaaggt acttatgaca aacttgatga agatggtatc
     2101 gtcaatcctg gcgtgcgtgt ttctggtgag gatatcatca tcggcaagac cgctccgctc
     2161 gcgccggatg cagaagagtt gggccaacgg accaagaacc acaccaagtt ggatgtgtcg
     2221 acaccgctcc gcagcacgga aaatggtatc gtcgaccagg tcttggttac gaccactcca
     2281 gacagcttga ggtcggtcaa ggttcggatg cgaatgacca aggttcctca gattggagac
     2341 aagttcgcgt ctcgtcacgg tcagaagggt acgattggta tcacctaccg acaggaagac
     2401 atgccattta cccgcgaggg tgtgacgccg gatctcatca tcaacccgca cgccattccc
     2461 tctcgtatga ccattgccca cttgatcgag tgtcaactca gcaaagtgtc tgctttgcgt
     2521 ggtttcgaag gtgatgctac tccgttcaca gatgtcaccg tcgactcgat ctctcgtctt
     2581 ctccgcgaac acggctacca gtcgcgtgga ttcgaggtca tgtacaacgg ccacactgga
     2641 cgcaagcttg tagcccaagt cttcctggga ccaacgtact atcagcgtct gcgccacatg
     2701 gtggacgaca agatccacgc gcgtgcgcgg ggtccgacgc agattctgac gcggcagcca
     2761 gtggaaggtc gtgctcgcga cggtggtctt cgcttcggag agatggagcg tgactgtatg
     2821 attgcgcatg gagctagtgc cttcttgaag gagcgattat tcgacgtctc ggacccgttc
     2881 agagtccaca tctgcgacga ctgcgggctg atgaccccga tagcgaaatt gaagaagggg
     2941 ttgttcgagt gccggctctg caacaataag caccggattt cgcaggtgca tattccgtat
     3001 gcagccaaac ttctgttcca agaattggcg gcgatgaata tctcggctcg gatgttcacc
     3061 aatcggtccg gcgtgtccgt gcggtag
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA