Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_676990                486 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN8813.2), mRNA.
ACCESSION   XM_676990 XM_412950
VERSION     XM_676990.1  GI:67903651
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 486)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 486)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101402).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..486
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="III"
     gene            <1..>486
                     /locus_tag="AN8813.2"
                     /db_xref="GeneID:2868335"
     CDS             1..486
                     /locus_tag="AN8813.2"
                     /note="similar to ABC transporter"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_682082.1"
                     /db_xref="GI:67903652"
                     /db_xref="GeneID:2868335"
                     /translation="MTALMGASGAGKTTLLDVLAARKNIGVISGDILVDGAKPGTSFQ
                     RGTSYAEQMDVHEPMQTVREALRFSADLRQSYDVPQSEKYAYVEEIISLLELENLADA
                     VIGTPETGLSVEERKRVTIGVELAAKPEMLLFLDEPTSGLDSQSAFNSKLTMAMLLTY
                     S"
ORIGIN      
        1 ctgacggcct tgatgggcgc atccggagcg gggaagacga ccctgcttga cgttctcgcc
       61 gcgcgaaaga acattggcgt aatttctggc gacattttgg tagatggtgc caagcctggt
      121 acatcgttcc aacgaggcac ttcctatgca gagcaaatgg atgtccatga acctatgcag
      181 acggtgcgcg aggcactgcg tttctcagcc gaccttcgtc aatcgtatga cgtcccgcag
      241 tcggagaaat atgcttatgt ggaagagatc atctctctgc tggagctgga gaatcttgca
      301 gatgcagtga ttggcacgcc tgagactggc ctgtctgtcg aggagaggaa gcgtgtcact
      361 atcggtgttg agctggcagc gaagccggaa atgctgctat ttttggatga gcctacttct
      421 ggtctggaca gccaatctgc gttcaatagt aagttgacaa tggccatgct cttgacttat
      481 agttaa
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA