Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_676972                843 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN8795.2), mRNA.
ACCESSION   XM_676972 XM_412932
VERSION     XM_676972.1  GI:67903615
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 843)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 843)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101402).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..843
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="III"
     gene            1..843
                     /locus_tag="AN8795.2"
                     /db_xref="GeneID:2868420"
     CDS             1..843
                     /locus_tag="AN8795.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_682064.1"
                     /db_xref="GI:67903616"
                     /db_xref="GeneID:2868420"
                     /translation="MEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLLVSAT
                     GNVLRSEILGAIKMKCYLSGMPELRLGLNDKVMFETTGRASRGKAVEMEDVKFHQCVR
                     LSRFENDRTISFIPPDGEFELMSYRLNTQYMLKAKAQFKRRSTANNVEILVPVPDDAD
                     SPRFRTNIGTVHYAPEKSAIVWKIKQFGGGKEFLMRAELGLPSVKGDDELGGGMTGGF
                     GGSMGGTMQGKAKRPINVKFEIPYFTTSGIQVRYLKITEPKVCQLSPFSFALFYIISS
                     CLVT"
ORIGIN      
        1 ctggaagttc aggcccgacc acctatcgcc gtcacaaatg cagtctcttg gcgaagtgaa
       61 ggcatccgct accgcaagaa cgaagttttc ctcgatgtgg ttgaatctct caatctcctc
      121 gtatccgcga ctggaaacgt gctacggtca gagattctgg gcgctatcaa gatgaagtgt
      181 tatctgagcg gaatgccgga gctccgtctc ggcttgaacg acaaggtcat gttcgagaca
      241 accggtcggg catcgcgggg taaggccgtc gagatggagg atgtgaagtt tcatcaatgt
      301 gtccggctgt ctcggttcga gaatgaccgc acaatcagct tcatcccgcc ggatggagag
      361 ttcgagctaa tgagctaccg tctgaacaca caatacatgt tgaaggccaa agcccaattc
      421 aaacgccgca gcacggccaa caacgtcgaa atccttgtcc ccgtcccgga cgatgctgac
      481 tcccctcgct tccgcacaaa catcggcaca gtccactacg cgcctgaaaa gtccgccatc
      541 gtttggaaga taaagcagtt cggcggcggc aaggagtttc ttatgcgcgc agaactgggc
      601 ctcccctccg tcaagggcga cgacgagctt ggtggcggta tgaccggtgg ctttggcggg
      661 agtatgggcg gtactatgca ggggaaggca aagaggccga ttaatgtcaa atttgagatt
      721 ccctatttca caactagtgg aattcaggtg cggtatttga agatcacaga gccgaaggtt
      781 tgtcagctca gcccattttc ctttgctctc ttttacatca tttcatcctg cttggtaact
      841 taa
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA