Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_676421               2082 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN8244.2), mRNA.
ACCESSION   XM_676421 XM_412381
VERSION     XM_676421.1  GI:67902513
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 2082)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2082)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101386).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2082
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="II"
     gene            <1..>2082
                     /locus_tag="AN8244.2"
                     /db_xref="GeneID:2869192"
     CDS             1..2082
                     /locus_tag="AN8244.2"
                     /note="similar to SNAD"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_681513.1"
                     /db_xref="GI:67902514"
                     /db_xref="GeneID:2869192"
                     /translation="MERYLLGEDDSINQDIDDEDKDQGQPQEESKRETEPLQPHDKPA
                     RPDSGQSNQPAVEDEAELGEYSEFGPPDDMSTPSHFLRRNVAPTKDTTHLEDIEENPN
                     DELSPAATPTVRKFKSQTNQDVKQADKDLRRQIAELTQAVKERDEQLERNRNRVIEAA
                     SAGEEVTHLRAELQRKTALLEDMQESHAERVIARRSSLNASDFRALQKQIADMQKDLN
                     SRSSHADIDTERLETISLLRQQLSLTQEQLEKRNAVLDDTLASLKQVTASKEQQLHEK
                     DAEIDRLRSQVDAQRAEIERLETDVAEAHREYRALEDQMVLLETKNRPLEEKNSTLEA
                     DLNRAQSQVTAQENALKAMAADLPTDTPGGTYSEILELIKDLGQPNTNRSTRPRDGSD
                     QDHDLEQIYEELSKLRTESSERAATNKNLEAQLSRAHDQAAESQLLIQSIEAENNRLV
                     RNTEELKSKLDKTFNELNRLRTEHSEAQETITRLQESQQAQAQAQIQQPSPPSTPHAN
                     PNTTSLSALEANHKAQIANLKTAHATALSTLRSAHADSTRKLRAFLSAAEARETELRS
                     LLEQEKEIHRNDEEEKDAEIQRLNSVIASKDETAAAMDLRIAKSVEKREREWERRVEL
                     LLKERERMGKALLWSWGEKEHPTKKAKGSISGSGKTAEVSSCETDKENVDDGRRHGQG
                     QPYRYKYVKKT"
ORIGIN      
        1 ttggaacgat atctccttgg cgaggatgac tcgataaatc aagatattga tgatgaggac
       61 aaggaccagg ggcagccaca ggaggaatcg aagcgcgaga cggaaccgtt acagcctcac
      121 gataaaccag cgcgaccaga tagcggccag tcgaatcaac cagcggtgga ggacgaggca
      181 gaactgggcg agtacagcga atttgggcct cccgatgata tgtctacgcc gtcgcatttt
      241 ctccgccgta atgtggctcc taccaaagac actactcatc ttgaagatat tgaggagaat
      301 ccgaatgatg agctgagtcc ggcagcgaca ccgacagttc ggaagttcaa atcacagacg
      361 aaccaagatg tgaaacaagc agataaggat ctacgccgtc agattgcaga gctgactcag
      421 gctgtaaagg agcgcgatga gcagttggaa aggaaccgca accgcgttat cgaagcggcg
      481 tccgctgggg aagaggttac gcacttgcga gccgaattac aaaggaagac cgccctgctg
      541 gaggatatgc aagagagtca tgcagagagg gtcatagcca gaagatcttc cctcaatgcg
      601 tctgactttc gggccctcca gaaacagatt gctgatatgc agaaagacct gaacagccgt
      661 agttcccatg ctgatattga taccgagcgt ctggagacca tttcattgct gcgccaacaa
      721 ctgtcgctga ctcaagagca attggaaaag cgcaatgccg tgctggatga tactcttgct
      781 agtttgaaac aagtcacagc gtcgaaagag caacagctcc acgaaaaaga cgctgagatt
      841 gacagactcc gcagtcaggt tgacgcccaa cgcgcggaaa ttgagagact cgaaacggac
      901 gtcgccgagg cgcatcgtga gtaccgagcg cttgaagacc aaatggttct gcttgaaacc
      961 aagaaccggc cattggaaga aaagaacagc acgctcgaag cagatttaaa tcgcgcccag
     1021 tctcaagtca cagctcagga gaatgccctc aaagccatgg cagcagactt gccgaccgat
     1081 accccgggtg gaacgtatag cgaaatcctt gaactgatca aagatctggg ccagccgaac
     1141 accaaccggt cgacgaggcc aagggacggc agcgaccagg atcacgacct tgaacagatt
     1201 tacgaagaac tatccaaact acgtactgaa tcaagcgagc gagctgcgac aaacaagaat
     1261 ttggaggccc aactctcgcg cgctcatgac caagccgcag aatctcagct cttgatccaa
     1321 tccatcgaag cagaaaataa tcgtcttgtt agaaacacag aagagctcaa atcaaagctg
     1381 gacaagacct tcaacgaatt aaaccgtctc cgcacagagc actccgaagc acaagagacg
     1441 attacacgcc tccaagaaag ccaacaagct caagctcaag cccaaatcca acaaccaagt
     1501 cccccctcaa caccccacgc aaacccaaat acaacttcgc tctctgctct tgaagcaaac
     1561 cacaaagccc agatcgccaa cctcaagacc gcccatgcaa cagccctctc tactcttcgc
     1621 tccgcccacg ccgactcaac tcgcaaactc cgcgctttcc tttctgccgc tgaagcccgg
     1681 gaaaccgaac tccgctctct gctcgaacaa gagaaagaaa tccaccgcaa cgacgaagag
     1741 gaaaaggatg cggagattca gcgtcttaac tctgtcatcg catccaagga cgaaacagcc
     1801 gccgccatgg atttgcgcat tgccaagtcc gttgagaagc gcgagcgcga gtgggagcgt
     1861 cgcgtggagt tgctgcttaa agagcgcgag aggatgggca aggcgctttt gtggagttgg
     1921 ggcgagaagg agcaccctac caagaaggct aagggaagta ttagcggtag tgggaagact
     1981 gctgaggttt ctagttgtga gaccgataag gaaaatgtag atgatggaag gagacatggg
     2041 caggggcagc cgtatagata taagtatgtg aagaagacgt ga
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA