Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_675431               2484 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN7254.2), mRNA.
ACCESSION   XM_675431 XM_411391
VERSION     XM_675431.1  GI:67900533
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 2484)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2484)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101365).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2484
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="IV"
     gene            1..2484
                     /locus_tag="AN7254.2"
                     /db_xref="GeneID:2869922"
     CDS             1..2484
                     /locus_tag="AN7254.2"
                     /note="similar to Cdc48p"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_680523.1"
                     /db_xref="GI:67900534"
                     /db_xref="GeneID:2869922"
                     /translation="MCCWGGSRSGTLNLCVNSRRVYVADASGAEKKEELDTSTAILKK
                     KKKPNSLIVTDAVNDDNSTISLSNNTMDTLGLFRGDTVTVRGKKRKETVLIVLADDDL
                     DDGSARINRVVRHNLRVKHGDIITVHPCPDIKYAKRIAVLPIADTVEGLTGSLFDVYL
                     APYFRDGYRPVKQGDLFTVRGGMRQVEFKVVEVDPPEFGIVAPDTIIHSEGEPIQRED
                     EENNLNEVGYDDIGGCRKQMAQIRELVELPLRHPQLFKSIGIKPPRGILMYGPPGTGK
                     TLMARAVANETGAFFFLINGPEIMSKMAGESESNLRKAFEEAEKNSPAIIFIDEIDSI
                     APKREKTNGEVERRVVSQLLTLMDGMKARSNVVVMAATNRPNSIDPALRRFGRFDREV
                     DIGIPDPTGRLEILSIHTKNMKLGEDVDLETIAAETHGYVGSDLASLCSEAAMQQIRE
                     KMDLIDLDEDTIDAEVLDSLGVTMENFRYALGVSNPSALREVAVVEVPNVRWEDIGGL
                     EEVKRELIESVQYPVDHPEKFQKFGLSPSRGVLFYGPPGTGKTMLAKAVANECAANFI
                     SVKGPELLSMWFGESESNIRDIFDKARAAAPCVVFLDELDSIAKSRGGSVGDAGGASD
                     RVVNQLLTEMDGMTSKKNVFVIGATNRPEQLDAALVRPGRLDTLVYVPLPDQASREGI
                     LKAQLRKTPVASDVDIEFIASKTHGFSGADLGFVTQRAVKLAIKESISAEIERQKQRE
                     AAGEDVKMEDEEEGEDPVPELTRAHFEEAMKTARRSVSDVEIRRYEAFAQSLKNSGGS
                     SFFRFPSANEAADSGNTFGEAGNDDSLYD"
ORIGIN      
        1 ttgtgttgtt ggggcggttc caggtccggc acactcaacc tttgcgtaaa ctctcgtcga
       61 gtctacgttg ctgatgcttc tggtgccgag aagaaagagg aactcgatac ctctacggcg
      121 attctgaaga agaagaagaa gcccaactcc ctaattgtta ctgatgccgt gaacgatgat
      181 aactctacaa tctccctctc caacaacacc atggacaccc ttgggctctt cagaggcgac
      241 acagtcacag tccgaggcaa aaagcgcaag gagactgttt tgattgtgct tgccgatgat
      301 gatctcgatg atggaagcgc ccgcatcaac agggtcgtca ggcataactt gcgcgtaaag
      361 cacggtgata tcatcacagt tcacccttgc cctgatatta aatatgctaa gcgtatcgcc
      421 gttctcccca ttgccgacac cgtcgagggc ctcacaggtt ctctttttga tgtctacctt
      481 gctccttact tccgagatgg gtaccgaccc gtgaagcaag gcgatctctt cacagtaaga
      541 ggtggcatgc gacaagttga gttcaaggtt gtcgaggtgg atcccccaga gttcggtatc
      601 gttgctccgg acactatcat tcacagtgag ggggagccca tccagcgtga ggatgaggag
      661 aacaacttaa acgaagttgg ctacgatgac atcggtggat gccgaaaaca gatggctcag
      721 atccgtgaat tggtcgagct gccgcttcgt caccctcaac tcttcaagtc catcggtatc
      781 aagcctcctc gtggtatcct tatgtacggt cctcccggta ctggtaagac gcttatggct
      841 cgtgctgtgg ccaacgagac tggcgctttc ttcttcttga ttaacggtcc tgagatcatg
      901 tccaagatgg ctggtgaatc tgagtcgaac cttcgcaagg ctttcgaaga agctgagaag
      961 aattcgcctg ctatcatctt tatcgatgaa atagactcga tcgcacctaa gcgtgagaag
     1021 accaacggag aggttgagcg ccgtgttgtc tcccagcttc tgactcttat ggatggtatg
     1081 aaggcgcgct ctaacgtcgt cgtcatggcc gccaccaacc gtcctaactc tatcgacccc
     1141 gctcttcgcc gcttcggccg tttcgaccgt gaagtcgaca ttggcattcc tgaccctacc
     1201 ggccgtcttg aaattctttc gatccacacc aagaacatga agcttggaga ggatgtcgac
     1261 ttagagacca tcgctgctga gactcatggt tacgtcggtt ccgatcttgc ttcgctctgt
     1321 tccgaggctg ccatgcagca gatccgtgaa aagatggatc tgatcgatct cgacgaagat
     1381 accattgatg cggaggtctt ggactcactt ggtgttacca tggagaactt ccgttatgcc
     1441 cttggcgttt ccaacccctc tgctctccgc gaggttgccg ttgtcgaggt ccccaatgtt
     1501 cgctgggagg atattggtgg tttggaggag gtcaagcgcg aacttatcga gagcgtccag
     1561 taccctgtcg atcatcccga gaagttccag aagttcggtc tgtcaccttc tcgcggtgtt
     1621 ttgttctatg gtcctcctgg tactggtaag accatgcttg caaaggccgt cgccaacgag
     1681 tgcgccgcaa acttcatatc cgttaagggc cctgaattgc tgagcatgtg gtttggtgag
     1741 tctgagagca acattcgtga cattttcgac aaggctcgtg ctgctgctcc ctgtgttgtg
     1801 ttcctcgatg aactggactc catcgccaaa tctcgtggcg gctccgtcgg agatgctggg
     1861 ggtgcttccg accgtgtcgt caaccagctt ctgactgaaa tggacggaat gacctcgaag
     1921 aagaacgttt tcgtcattgg tgccacgaac agacctgagc agctcgacgc tgccttggtg
     1981 cgtcccggcc gtctcgacac tctggtctac gttcctctgc ccgaccaagc ctctcgtgag
     2041 ggtatcctca aggctcagct ccgcaagact cctgtcgctt ccgatgtcga catcgagttc
     2101 attgccagca aaactcacgg cttctctggt gctgatctcg gattcgtcac ccagcgagct
     2161 gtcaagcttg ctatcaagga atccatctct gctgaaattg agcgtcagaa gcagcgtgaa
     2221 gctgctggtg aggatgttaa gatggaggat gaggaggaag gcgaagaccc cgtgccagaa
     2281 ctcacgcggg ctcatttcga agaggctatg aagacagccc gacgatctgt cagcgatgtg
     2341 gagattcgcc gatatgaagc tttcgctcag agcctgaaga attccggcgg cagctctttc
     2401 ttccgcttcc cctctgccaa tgaggctgcg gatagcggca acacatttgg tgaagccggt
     2461 aatgacgaca gcctctatga ttaa
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA