Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_659054               1131 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 actin (AN6542.2), mRNA.
ACCESSION   XM_659054 XM_410679
VERSION     XM_659054.1  GI:67540743
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 1131)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1131)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101350).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1131
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="I"
     gene            1..1131
                     /locus_tag="AN6542.2"
                     /db_xref="GeneID:2870269"
     CDS             1..1131
                     /locus_tag="AN6542.2"
                     /codon_start=1
                     /product="actin"
                     /protein_id="XP_664146.1"
                     /db_xref="GI:67540744"
                     /db_xref="GeneID:2870269"
                     /translation="MPTEEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGI
                     MIGMGQKDSYVGDEAQSKRGILTLRYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEH
                     PVLLTEAPINPKSNREKMTQIVFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGV
                     THVVPIYEGFALPHAISRVDMAGRDLTDYLMKILAERGYTFSTTAEREIVRDIKEKLC
                     YVALDFEQEIQTASQSSSLEKSYELPDGQVITIGNERFRAPEALFQPSVLGLESGGIH
                     VTTFNSIMKCDVDVRKDLYGNIVMSGGTTMYPGISDRMQKEITALAPSSMKVKIIAPP
                     ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
ORIGIN      
        1 ctgcctacag aggaagttgc tgctctcgtt atcgacaatg gttcgggtat gtgcaaggcc
       61 ggtttcgccg gtgacgatgc cccccgtgcc gtcttcccct ccattgtcgg tcgtccccgt
      121 caccatggta tcatgatcgg tatgggtcag aaggactcct acgtcggtga tgaggcacag
      181 tccaagcgtg gtatcctcac actcagatac cccattgagc acggtgttgt cacgaactgg
      241 gatgacatgg agaagatttg gcaccacaca ttctacaacg agcttcgtgt cgctcctgag
      301 gagcaccccg ttctcttgac cgaagccccc atcaatccca agtccaaccg tgagaagatg
      361 actcagatcg tcttcgagac tttcaacgct cccgccttct acgtctctat tcaggccgtt
      421 ctctccctgt atgcttccgg tcgtaccacc ggtatcgtcc ttgactctgg tgatggtgtt
      481 acccacgtcg tccccatcta cgagggtttc gctcttcccc acgccatctc ccgtgtcgac
      541 atggctggtc gtgacctgac ggactacctg atgaagatct tggccgagcg cggatacacc
      601 ttctccacta ccgctgagcg tgaaattgtc cgtgacatca aggagaagct ctgctacgtc
      661 gcccttgact tcgagcagga gatccagacc gcttctcaga gctccagcct cgagaagtcc
      721 tacgaactgc ctgatggtca ggttatcacc atcggcaacg agcgcttccg tgctcctgag
      781 gctctcttcc agcccagcgt tcttggtctg gaaagcggtg gtatccacgt caccactttc
      841 aactctatca tgaagtgtga tgtcgacgtc cgtaaggatc tgtacggcaa catcgttatg
      901 tctggtggta ccaccatgta ccctggtatc tccgaccgta tgcagaagga aatcaccgcc
      961 cttgcgccct catccatgaa ggtcaagatc attgctcctc ctgagcgcaa atactccgtc
     1021 tggatcggtg gttccatctt ggcttctctg tccaccttcc aacagatgtg gatctccaag
     1081 caggagtacg atgagagcgg tccttcgatc gtccaccgca agtgcttcta a
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA