Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_658829               2148 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN6317.2), mRNA.
ACCESSION   XM_658829 XM_410454
VERSION     XM_658829.1  GI:67540293
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 2148)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2148)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101348).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2148
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="I"
     gene            1..2148
                     /locus_tag="AN6317.2"
                     /db_xref="GeneID:2870964"
     CDS             1..2148
                     /locus_tag="AN6317.2"
                     /note="similar to AF429307_1 chitin synthase"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_663921.1"
                     /db_xref="GI:67540294"
                     /db_xref="GeneID:2870964"
                     /translation="MICAVVLVKFLAALQLGSKRRPAPQDKFVICMVPAYTEGEDSLR
                     KGLDSLTALQYDNKRKLIFVICDGMIVGGGNDRPTPKIVLDILGVDPKIDPPALPVKS
                     IGQGNEQLNYGKVYSGLYEYEGNVVPYVVVVKVGKESEQNKSKPGNRGKRDSQVLLLN
                     FLSRVHHRAPMSPLELEVFHQINNVIGVDPELYEYCLMVDADTSVREDSLNRLVAACA
                     NDARIAGICGETSLQNEERSWWTMIQVYEYFISHHLAKAFESLFGSVTCLPGCFCMYR
                     LRTADRGRPLIISEKLLEEYSDNNVDTLHKKNLLALGEDRYLTTLMTKHFPTMSYKFI
                     PDAFASTAAPETWSVLLSQRRRWINSTIHNLVELAALKDLCGFCCFSMRFVVMVDLLG
                     TIILPATCVYLGYLIYRVASDTGPFPMISIVMLAGIYGLQAIIFIIKRQWQHIGWMII
                     YLCAYPIYSFILPLYSFWKQDDFSWGNTRVVIEEKGSKRIVAVEDEQFDPRSIPLQRW
                     DDYALANNLPGRRGDYAVGQEKAFYGGRYMDDTAMEMDDMHSQYSSVKPASTILTGFP
                     GQGRHSYMPPQSPAPFGGNVPGNRNSHFSTFSRYTDQPLQSNSHLQTRHMSMGNLSQL
                     ESSGMTNRHSVGMMQSTDNLLRPNSRSPVGFNSRPASAFDFRAGMNGPDEGAITEAIR
                     SCLAEVDLDTVTKKQGKCLSSPSLSLRKQTNLQ"
ORIGIN      
        1 ttgatttgcg cagttgttct tgtcaagttc cttgccgctc tccagctagg gtcaaagcgc
       61 cgtccagccc ctcaagacaa attcgtgatc tgcatggtac ctgcttatac tgaaggcgaa
      121 gactcgctac gcaaaggtct cgactcactc actgcgcttc aatacgacaa caagagaaag
      181 ctgatctttg tgatttgtga tggtatgatt gttggtggtg gtaacgaccg gccgacgccg
      241 aaaattgtcc tggacattct tggagttgat cccaaaatcg accctccagc gttgcctgtc
      301 aaatctatcg gccaaggcaa cgaacagctt aattacggta aagtgtactc tggactgtac
      361 gaatatgaag gcaacgtggt gccttatgtg gtcgttgtca aggtcggcaa ggagtcagag
      421 cagaacaaat ccaagcccgg taacaggggt aaacgagact ctcaggttct ccttctcaat
      481 ttcctcagcc gcgttcacca ccgtgccccg atgtcccctc ttgagctgga agttttccac
      541 cagatcaaca atgtcattgg cgttgaccct gagctttatg agtactgcct gatggtagac
      601 gcggatacaa gtgtacgtga ggattccctc aatcgccttg tagctgcgtg cgccaatgat
      661 gctcgcattg ctggtatttg cggggaaacg agtcttcaaa acgaggaacg aagttggtgg
      721 acaatgatac aggtttatga atacttcatc tctcatcatt tggccaaggc tttcgagtct
      781 ttgtttggca gcgttacctg tcttcccgga tgtttctgta tgtaccgtct tcgcacagca
      841 gaccgcggtc gtcctttaat tatatcggag aagcttcttg aggagtattc ggataataat
      901 gtcgatacgc tacacaagaa gaacttgctg gcccttggtg aagatcgata tctcaccact
      961 ctcatgacca agcattttcc caccatgtct tacaagttca tccccgatgc tttcgctagc
     1021 acggcggctc ctgagacatg gtcagtcctt ctgtcgcagc gacgtcggtg gatcaactct
     1081 acaatccaca acctggttga gttggcggcc ttgaaagacc tttgcggatt ctgttgtttc
     1141 agtatgcgtt ttgtggtaat ggttgacctt ctgggtacaa tcatccttcc agcgacctgc
     1201 gtctaccttg gatatctgat ctaccgcgtt gcgagcgaca cggggccctt cccaatgatc
     1261 tccattgtca tgctggctgg tatctacggt cttcaggcga ttattttcat aatcaaacgc
     1321 cagtggcagc acattggatg gatgattatc tatctctgtg cataccccat ctacagtttc
     1381 atccttccgt tgtattcctt ctggaagcag gacgacttca gttggggtaa tactcgtgta
     1441 gtcattgagg agaagggttc gaagcgcatt gtcgcggtgg aggacgagca attcgatccc
     1501 cgcagtatcc cccttcagcg ctgggacgac tatgccctag ccaacaacct tcccgggcgc
     1561 cgcggtgact acgccgtcgg ccaagagaag gctttctatg gcggtcgcta catggatgac
     1621 acggcgatgg aaatggatga catgcattcg cagtactcct ctgtcaagcc cgcttcgacg
     1681 attctcactg gcttccccgg tcaaggtcgg cattcgtaca tgccgccgca atccccagct
     1741 ccctttggcg gaaatgtccc tggtaaccgc aactcgcact tttccacctt ttcccggtac
     1801 accgaccagc ctctccagag caacagtcat ctgcagaccc gccatatgtc aatgggcaac
     1861 ctcagccagc tggagagcag cggcatgacc aaccgccaca gcgtcggaat gatgcaaagc
     1921 acagataacc ttcttcgacc taactcgcgc agcccggtag ggtttaactc gcggcctgcc
     1981 agcgcgttcg atttccgggc gggcatgaac gggcccgacg agggtgcaat cacggaggca
     2041 atccggagct gtctcgcaga ggtcgacctc gacaccgtta ccaaaaagca gggtaagtgt
     2101 ctttcttctc cctccctgtc tcttcgcaag caaactaacc tgcaatag
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA