Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
<?xml version="1.0"?>
<!DOCTYPE Bioseq-set PUBLIC "-//NCBI//NCBI Seqset/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_Seqset.dtd">
<Bioseq-set>
<Bioseq-set_seq-set>
<Seq-entry>
  <Seq-entry_set>
    <Bioseq-set>
      <Bioseq-set_class value="nuc-prot"/>
      <Bioseq-set_descr>
        <Seq-descr>
          <Seqdesc>
            <Seqdesc_source>
              <BioSource>
                <BioSource_org>
                  <Org-ref>
                    <Org-ref_taxname>Aspergillus nidulans FGSC A4</Org-ref_taxname>
                    <Org-ref_db>
                      <Dbtag>
                        <Dbtag_db>taxon</Dbtag_db>
                        <Dbtag_tag>
                          <Object-id>
                            <Object-id_id>227321</Object-id_id>
                          </Object-id>
                        </Dbtag_tag>
                      </Dbtag>
                    </Org-ref_db>
                    <Org-ref_orgname>
                      <OrgName>
                        <OrgName_name>
                          <OrgName_name_binomial>
                            <BinomialOrgName>
                              <BinomialOrgName_genus>Emericella</BinomialOrgName_genus>
                              <BinomialOrgName_species>nidulans</BinomialOrgName_species>
                            </BinomialOrgName>
                          </OrgName_name_binomial>
                        </OrgName_name>
                        <OrgName_mod>
                          <OrgMod>
                            <OrgMod_subtype value="strain">2</OrgMod_subtype>
                            <OrgMod_subname>FGSC A4</OrgMod_subname>
                          </OrgMod>
                        </OrgName_mod>
                        <OrgName_lineage>Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiales; Trichocomaceae; Emericella</OrgName_lineage>
                        <OrgName_gcode>1</OrgName_gcode>
                        <OrgName_mgcode>4</OrgName_mgcode>
                        <OrgName_div>PLN</OrgName_div>
                      </OrgName>
                    </Org-ref_orgname>
                  </Org-ref>
                </BioSource_org>
                <BioSource_subtype>
                  <SubSource>
                    <SubSource_subtype value="chromosome">1</SubSource_subtype>
                    <SubSource_name>I</SubSource_name>
                  </SubSource>
                </BioSource_subtype>
              </BioSource>
            </Seqdesc_source>
          </Seqdesc>
          <Seqdesc>
            <Seqdesc_pub>
              <Pubdesc>
                <Pubdesc_pub>
                  <Pub-equiv>
                    <Pub>
                      <Pub_gen>
                        <Cit-gen>
                          <Cit-gen_cit>Unpublished</Cit-gen_cit>
                          <Cit-gen_authors>
                            <Auth-list>
                              <Auth-list_names>
                                <Auth-list_names_std>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Birren</Name-std_last>
                                            <Name-std_first>Bruce</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Nusbaum</Name-std_last>
                                            <Name-std_first>Chad</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Abouelleil</Name-std_last>
                                            <Name-std_first>Amr</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Allen</Name-std_last>
                                            <Name-std_first>Nicole</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Anderson</Name-std_last>
                                            <Name-std_first>Scott</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Arachchi</Name-std_last>
                                            <Name-std_first>Harindra</Name-std_first>
                                            <Name-std_middle>Meetiyamulla</Name-std_middle>
                                            <Name-std_initials>H.M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Barna</Name-std_last>
                                            <Name-std_first>Nicole</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Bastien</Name-std_last>
                                            <Name-std_first>Vertida</Name-std_first>
                                            <Name-std_initials>V.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Bloom</Name-std_last>
                                            <Name-std_first>Toby</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Boguslavkiy</Name-std_last>
                                            <Name-std_first>Leonid</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Boukhgalter</Name-std_last>
                                            <Name-std_first>Boris</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Butler</Name-std_last>
                                            <Name-std_first>Jonathan</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Calvo</Name-std_last>
                                            <Name-std_first>Sarah</Name-std_first>
                                            <Name-std_initials>S.E.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Camarata</Name-std_last>
                                            <Name-std_first>Jody</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Chang</Name-std_last>
                                            <Name-std_first>Jean</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Choepel</Name-std_last>
                                            <Name-std_first>Yama</Name-std_first>
                                            <Name-std_initials>Y.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Collymore</Name-std_last>
                                            <Name-std_first>Alville</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Cook</Name-std_last>
                                            <Name-std_first>April</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Cooke</Name-std_last>
                                            <Name-std_first>Patrick</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Corum</Name-std_last>
                                            <Name-std_first>Ben</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>DeArellano</Name-std_last>
                                            <Name-std_first>Kurt</Name-std_first>
                                            <Name-std_initials>K.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Diaz</Name-std_last>
                                            <Name-std_first>Jose</Name-std_first>
                                            <Name-std_middle>Sebastian</Name-std_middle>
                                            <Name-std_initials>J.S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Dodge</Name-std_last>
                                            <Name-std_first>Sheila</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Dooley</Name-std_last>
                                            <Name-std_first>Kathleen</Name-std_first>
                                            <Name-std_initials>K.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Dorris</Name-std_last>
                                            <Name-std_first>Lester</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Elkins</Name-std_last>
                                            <Name-std_first>Timothy</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Engels</Name-std_last>
                                            <Name-std_first>Reinhard</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Erickson</Name-std_last>
                                            <Name-std_first>Jeffrey</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Faro</Name-std_last>
                                            <Name-std_first>Susan</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Ferreira</Name-std_last>
                                            <Name-std_first>Patricia</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>FitzGerald</Name-std_last>
                                            <Name-std_first>Mike</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Gage</Name-std_last>
                                            <Name-std_first>Diane</Name-std_first>
                                            <Name-std_initials>D.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Galagan</Name-std_last>
                                            <Name-std_first>James</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Gardyna</Name-std_last>
                                            <Name-std_first>Stephanie</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Gnerre</Name-std_last>
                                            <Name-std_first>Sante</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Graham</Name-std_last>
                                            <Name-std_first>Leslie</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Grand-Pierre</Name-std_last>
                                            <Name-std_first>Nerline</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Hafez</Name-std_last>
                                            <Name-std_first>Nabil</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Hagopian</Name-std_last>
                                            <Name-std_first>Daniel</Name-std_first>
                                            <Name-std_initials>D.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Hagos</Name-std_last>
                                            <Name-std_first>Birhane</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Hall</Name-std_last>
                                            <Name-std_first>Jennifer</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Horton</Name-std_last>
                                            <Name-std_first>Lloyd</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Hulme</Name-std_last>
                                            <Name-std_first>William</Name-std_first>
                                            <Name-std_initials>W.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Iliev</Name-std_last>
                                            <Name-std_first>Ilian</Name-std_first>
                                            <Name-std_initials>I.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Jaffe</Name-std_last>
                                            <Name-std_first>David</Name-std_first>
                                            <Name-std_initials>D.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Johnson</Name-std_last>
                                            <Name-std_first>Robin</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Jones</Name-std_last>
                                            <Name-std_first>Charlien</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Kamal</Name-std_last>
                                            <Name-std_first>Michael</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Kamat</Name-std_last>
                                            <Name-std_first>Asha</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Karatas</Name-std_last>
                                            <Name-std_first>Aysen</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Kells</Name-std_last>
                                            <Name-std_first>Cristyn</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Landers</Name-std_last>
                                            <Name-std_first>Thomas</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Levine</Name-std_last>
                                            <Name-std_first>Rosie</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Lindblad-Toh</Name-std_last>
                                            <Name-std_first>Kerstin</Name-std_first>
                                            <Name-std_initials>K.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Liu</Name-std_last>
                                            <Name-std_first>Grace</Name-std_first>
                                            <Name-std_initials>G.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Lui</Name-std_last>
                                            <Name-std_first>Annie</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Ma</Name-std_last>
                                            <Name-std_first>Li-Jun</Name-std_first>
                                            <Name-std_initials>L.-J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Mabbitt</Name-std_last>
                                            <Name-std_first>Richard</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>MacLean</Name-std_last>
                                            <Name-std_first>Christine</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Macdonald</Name-std_last>
                                            <Name-std_first>Pen</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Major</Name-std_last>
                                            <Name-std_first>John</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Manning</Name-std_last>
                                            <Name-std_first>Jonathan</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Matthews</Name-std_last>
                                            <Name-std_first>Charles</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Mauceli</Name-std_last>
                                            <Name-std_first>Evan</Name-std_first>
                                            <Name-std_initials>E.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>McCarthy</Name-std_last>
                                            <Name-std_first>Megan</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Meldrim</Name-std_last>
                                            <Name-std_first>James</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Meneus</Name-std_last>
                                            <Name-std_first>Louis</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Mihova</Name-std_last>
                                            <Name-std_first>Tanya</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Mlenga</Name-std_last>
                                            <Name-std_first>Valentin</Name-std_first>
                                            <Name-std_initials>V.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Murphy</Name-std_last>
                                            <Name-std_first>Thomas</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Naylor</Name-std_last>
                                            <Name-std_first>Jerome</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Nguyen</Name-std_last>
                                            <Name-std_first>Cindy</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Nicol</Name-std_last>
                                            <Name-std_first>Robert</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Nielsen</Name-std_last>
                                            <Name-std_first>Cydney</Name-std_first>
                                            <Name-std_initials>C.B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Norbu</Name-std_last>
                                            <Name-std_first>Choe</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>O'Connor</Name-std_last>
                                            <Name-std_first>Tara</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>O'Donnell</Name-std_last>
                                            <Name-std_first>Paula</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>O'Neil</Name-std_last>
                                            <Name-std_first>Dominic</Name-std_first>
                                            <Name-std_initials>D.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Oliver</Name-std_last>
                                            <Name-std_first>Jill</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Peterson</Name-std_last>
                                            <Name-std_first>Kris</Name-std_first>
                                            <Name-std_initials>K.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Phunkhang</Name-std_last>
                                            <Name-std_first>Pema</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Pierre</Name-std_last>
                                            <Name-std_first>Nadia</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Purcell</Name-std_last>
                                            <Name-std_first>Seth</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Rachupka</Name-std_last>
                                            <Name-std_first>Anthony</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Ramasamy</Name-std_last>
                                            <Name-std_first>Umadevi</Name-std_first>
                                            <Name-std_initials>U.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Raymond</Name-std_last>
                                            <Name-std_first>Christina</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Retta</Name-std_last>
                                            <Name-std_first>Rahel</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Rise</Name-std_last>
                                            <Name-std_first>Cecil</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Rogov</Name-std_last>
                                            <Name-std_first>Peter</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Roman</Name-std_last>
                                            <Name-std_first>Joseph</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Schauer</Name-std_last>
                                            <Name-std_first>Steve</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Schupback</Name-std_last>
                                            <Name-std_first>Rebecca</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Seaman</Name-std_last>
                                            <Name-std_first>Steven</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Severy</Name-std_last>
                                            <Name-std_first>Peter</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Smirnov</Name-std_last>
                                            <Name-std_first>Serge</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Smith</Name-std_last>
                                            <Name-std_first>Cherylyn</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Spencer</Name-std_last>
                                            <Name-std_first>Brian</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Stange-Thomann</Name-std_last>
                                            <Name-std_first>Nicole</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Stojanovic</Name-std_last>
                                            <Name-std_first>Nikola</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Stubbs</Name-std_last>
                                            <Name-std_first>Matthew</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Talamas</Name-std_last>
                                            <Name-std_first>Jessica</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Tesfaye</Name-std_last>
                                            <Name-std_first>Senait</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Theodore</Name-std_last>
                                            <Name-std_first>Joumathe</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Topham</Name-std_last>
                                            <Name-std_first>Kerri</Name-std_first>
                                            <Name-std_initials>K.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Travers</Name-std_last>
                                            <Name-std_first>Mary</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Vassiliev</Name-std_last>
                                            <Name-std_first>Helen</Name-std_first>
                                            <Name-std_initials>H.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Venkataraman</Name-std_last>
                                            <Name-std_first>Vijay</Name-std_first>
                                            <Name-std_middle>Sree</Name-std_middle>
                                            <Name-std_initials>V.S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Viel</Name-std_last>
                                            <Name-std_first>Rose</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Vo</Name-std_last>
                                            <Name-std_first>Andy</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Wang</Name-std_last>
                                            <Name-std_first>Shunguang</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Wilson</Name-std_last>
                                            <Name-std_first>Bennett</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Wu</Name-std_last>
                                            <Name-std_first>Xiaoyun</Name-std_first>
                                            <Name-std_initials>X.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Wyman</Name-std_last>
                                            <Name-std_first>Dudley</Name-std_first>
                                            <Name-std_initials>D.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Young</Name-std_last>
                                            <Name-std_first>Geneva</Name-std_first>
                                            <Name-std_initials>G.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Zainoun</Name-std_last>
                                            <Name-std_first>Joanne</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Zembek</Name-std_last>
                                            <Name-std_first>Lisa</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Zimmer</Name-std_last>
                                            <Name-std_first>Andrew</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Zody</Name-std_last>
                                            <Name-std_first>Michael</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Lander</Name-std_last>
                                            <Name-std_first>Eric</Name-std_first>
                                            <Name-std_initials>E.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                </Auth-list_names_std>
                              </Auth-list_names>
                              <Auth-list_affil>
                                <Affil>
                                  <Affil_std>
                                    <Affil_std_affil>Broad Institute</Affil_std_affil>
                                    <Affil_std_city>Cambridge</Affil_std_city>
                                    <Affil_std_sub>MA</Affil_std_sub>
                                    <Affil_std_country>USA</Affil_std_country>
                                    <Affil_std_street>320 Charles Street</Affil_std_street>
                                    <Affil_std_postal-code>02142</Affil_std_postal-code>
                                  </Affil_std>
                                </Affil>
                              </Auth-list_affil>
                            </Auth-list>
                          </Cit-gen_authors>
                          <Cit-gen_title>Genome Sequence of Aspergillus nidulans</Cit-gen_title>
                        </Cit-gen>
                      </Pub_gen>
                    </Pub>
                  </Pub-equiv>
                </Pubdesc_pub>
              </Pubdesc>
            </Seqdesc_pub>
          </Seqdesc>
          <Seqdesc>
            <Seqdesc_pub>
              <Pubdesc>
                <Pubdesc_pub>
                  <Pub-equiv>
                    <Pub>
                      <Pub_sub>
                        <Cit-sub>
                          <Cit-sub_authors>
                            <Auth-list>
                              <Auth-list_names>
                                <Auth-list_names_std>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Birren</Name-std_last>
                                            <Name-std_first>Bruce</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Nusbaum</Name-std_last>
                                            <Name-std_first>Chad</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Abouelleil</Name-std_last>
                                            <Name-std_first>Amr</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Allen</Name-std_last>
                                            <Name-std_first>Nicole</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Anderson</Name-std_last>
                                            <Name-std_first>Scott</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Arachchi</Name-std_last>
                                            <Name-std_first>Harindra</Name-std_first>
                                            <Name-std_middle>Meetiyamulla</Name-std_middle>
                                            <Name-std_initials>H.M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Barna</Name-std_last>
                                            <Name-std_first>Nicole</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Bastien</Name-std_last>
                                            <Name-std_first>Vertida</Name-std_first>
                                            <Name-std_initials>V.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Bloom</Name-std_last>
                                            <Name-std_first>Toby</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Boguslavkiy</Name-std_last>
                                            <Name-std_first>Leonid</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Boukhgalter</Name-std_last>
                                            <Name-std_first>Boris</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Butler</Name-std_last>
                                            <Name-std_first>Jonathan</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Calvo</Name-std_last>
                                            <Name-std_first>Sarah</Name-std_first>
                                            <Name-std_initials>S.E.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Camarata</Name-std_last>
                                            <Name-std_first>Jody</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Chang</Name-std_last>
                                            <Name-std_first>Jean</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Choepel</Name-std_last>
                                            <Name-std_first>Yama</Name-std_first>
                                            <Name-std_initials>Y.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Collymore</Name-std_last>
                                            <Name-std_first>Alville</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Cook</Name-std_last>
                                            <Name-std_first>April</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Cooke</Name-std_last>
                                            <Name-std_first>Patrick</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Corum</Name-std_last>
                                            <Name-std_first>Ben</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>DeArellano</Name-std_last>
                                            <Name-std_first>Kurt</Name-std_first>
                                            <Name-std_initials>K.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Diaz</Name-std_last>
                                            <Name-std_first>Jose</Name-std_first>
                                            <Name-std_middle>Sebastian</Name-std_middle>
                                            <Name-std_initials>J.S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Dodge</Name-std_last>
                                            <Name-std_first>Sheila</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Dooley</Name-std_last>
                                            <Name-std_first>Kathleen</Name-std_first>
                                            <Name-std_initials>K.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Dorris</Name-std_last>
                                            <Name-std_first>Lester</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Elkins</Name-std_last>
                                            <Name-std_first>Timothy</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Engels</Name-std_last>
                                            <Name-std_first>Reinhard</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Erickson</Name-std_last>
                                            <Name-std_first>Jeffrey</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Faro</Name-std_last>
                                            <Name-std_first>Susan</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Ferreira</Name-std_last>
                                            <Name-std_first>Patricia</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>FitzGerald</Name-std_last>
                                            <Name-std_first>Mike</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Gage</Name-std_last>
                                            <Name-std_first>Diane</Name-std_first>
                                            <Name-std_initials>D.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Galagan</Name-std_last>
                                            <Name-std_first>James</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Gardyna</Name-std_last>
                                            <Name-std_first>Stephanie</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Gnerre</Name-std_last>
                                            <Name-std_first>Sante</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Graham</Name-std_last>
                                            <Name-std_first>Leslie</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Grand-Pierre</Name-std_last>
                                            <Name-std_first>Nerline</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Hafez</Name-std_last>
                                            <Name-std_first>Nabil</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Hagopian</Name-std_last>
                                            <Name-std_first>Daniel</Name-std_first>
                                            <Name-std_initials>D.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Hagos</Name-std_last>
                                            <Name-std_first>Birhane</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Hall</Name-std_last>
                                            <Name-std_first>Jennifer</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Horton</Name-std_last>
                                            <Name-std_first>Lloyd</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Hulme</Name-std_last>
                                            <Name-std_first>William</Name-std_first>
                                            <Name-std_initials>W.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Iliev</Name-std_last>
                                            <Name-std_first>Ilian</Name-std_first>
                                            <Name-std_initials>I.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Jaffe</Name-std_last>
                                            <Name-std_first>David</Name-std_first>
                                            <Name-std_initials>D.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Johnson</Name-std_last>
                                            <Name-std_first>Robin</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Jones</Name-std_last>
                                            <Name-std_first>Charlien</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Kamal</Name-std_last>
                                            <Name-std_first>Michael</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Kamat</Name-std_last>
                                            <Name-std_first>Asha</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Karatas</Name-std_last>
                                            <Name-std_first>Aysen</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Kells</Name-std_last>
                                            <Name-std_first>Cristyn</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Landers</Name-std_last>
                                            <Name-std_first>Thomas</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Levine</Name-std_last>
                                            <Name-std_first>Rosie</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Lindblad-Toh</Name-std_last>
                                            <Name-std_first>Kerstin</Name-std_first>
                                            <Name-std_initials>K.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Liu</Name-std_last>
                                            <Name-std_first>Grace</Name-std_first>
                                            <Name-std_initials>G.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Lui</Name-std_last>
                                            <Name-std_first>Annie</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Ma</Name-std_last>
                                            <Name-std_first>Li-Jun</Name-std_first>
                                            <Name-std_initials>L.-J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Mabbitt</Name-std_last>
                                            <Name-std_first>Richard</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>MacLean</Name-std_last>
                                            <Name-std_first>Christine</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Macdonald</Name-std_last>
                                            <Name-std_first>Pen</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Major</Name-std_last>
                                            <Name-std_first>John</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Manning</Name-std_last>
                                            <Name-std_first>Jonathan</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Matthews</Name-std_last>
                                            <Name-std_first>Charles</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Mauceli</Name-std_last>
                                            <Name-std_first>Evan</Name-std_first>
                                            <Name-std_initials>E.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>McCarthy</Name-std_last>
                                            <Name-std_first>Megan</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Meldrim</Name-std_last>
                                            <Name-std_first>James</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Meneus</Name-std_last>
                                            <Name-std_first>Louis</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Mihova</Name-std_last>
                                            <Name-std_first>Tanya</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Mlenga</Name-std_last>
                                            <Name-std_first>Valentin</Name-std_first>
                                            <Name-std_initials>V.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Murphy</Name-std_last>
                                            <Name-std_first>Thomas</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Naylor</Name-std_last>
                                            <Name-std_first>Jerome</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Nguyen</Name-std_last>
                                            <Name-std_first>Cindy</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Nicol</Name-std_last>
                                            <Name-std_first>Robert</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Nielsen</Name-std_last>
                                            <Name-std_first>Cydney</Name-std_first>
                                            <Name-std_initials>C.B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Norbu</Name-std_last>
                                            <Name-std_first>Choe</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>O'Connor</Name-std_last>
                                            <Name-std_first>Tara</Name-std_first>
                                            <Name-std_initials>T.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>O'Donnell</Name-std_last>
                                            <Name-std_first>Paula</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>O'Neil</Name-std_last>
                                            <Name-std_first>Dominic</Name-std_first>
                                            <Name-std_initials>D.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Oliver</Name-std_last>
                                            <Name-std_first>Jill</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Peterson</Name-std_last>
                                            <Name-std_first>Kris</Name-std_first>
                                            <Name-std_initials>K.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Phunkhang</Name-std_last>
                                            <Name-std_first>Pema</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Pierre</Name-std_last>
                                            <Name-std_first>Nadia</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Purcell</Name-std_last>
                                            <Name-std_first>Seth</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Rachupka</Name-std_last>
                                            <Name-std_first>Anthony</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Ramasamy</Name-std_last>
                                            <Name-std_first>Umadevi</Name-std_first>
                                            <Name-std_initials>U.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Raymond</Name-std_last>
                                            <Name-std_first>Christina</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Retta</Name-std_last>
                                            <Name-std_first>Rahel</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Rise</Name-std_last>
                                            <Name-std_first>Cecil</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Rogov</Name-std_last>
                                            <Name-std_first>Peter</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Roman</Name-std_last>
                                            <Name-std_first>Joseph</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Schauer</Name-std_last>
                                            <Name-std_first>Steve</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Schupback</Name-std_last>
                                            <Name-std_first>Rebecca</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Seaman</Name-std_last>
                                            <Name-std_first>Steven</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Severy</Name-std_last>
                                            <Name-std_first>Peter</Name-std_first>
                                            <Name-std_initials>P.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Smirnov</Name-std_last>
                                            <Name-std_first>Serge</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Smith</Name-std_last>
                                            <Name-std_first>Cherylyn</Name-std_first>
                                            <Name-std_initials>C.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Spencer</Name-std_last>
                                            <Name-std_first>Brian</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Stange-Thomann</Name-std_last>
                                            <Name-std_first>Nicole</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Stojanovic</Name-std_last>
                                            <Name-std_first>Nikola</Name-std_first>
                                            <Name-std_initials>N.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Stubbs</Name-std_last>
                                            <Name-std_first>Matthew</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Talamas</Name-std_last>
                                            <Name-std_first>Jessica</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Tesfaye</Name-std_last>
                                            <Name-std_first>Senait</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Theodore</Name-std_last>
                                            <Name-std_first>Joumathe</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Topham</Name-std_last>
                                            <Name-std_first>Kerri</Name-std_first>
                                            <Name-std_initials>K.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Travers</Name-std_last>
                                            <Name-std_first>Mary</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Vassiliev</Name-std_last>
                                            <Name-std_first>Helen</Name-std_first>
                                            <Name-std_initials>H.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Venkataraman</Name-std_last>
                                            <Name-std_first>Vijay</Name-std_first>
                                            <Name-std_middle>Sree</Name-std_middle>
                                            <Name-std_initials>V.S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Viel</Name-std_last>
                                            <Name-std_first>Rose</Name-std_first>
                                            <Name-std_initials>R.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Vo</Name-std_last>
                                            <Name-std_first>Andy</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Wang</Name-std_last>
                                            <Name-std_first>Shunguang</Name-std_first>
                                            <Name-std_initials>S.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Wilson</Name-std_last>
                                            <Name-std_first>Bennett</Name-std_first>
                                            <Name-std_initials>B.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Wu</Name-std_last>
                                            <Name-std_first>Xiaoyun</Name-std_first>
                                            <Name-std_initials>X.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Wyman</Name-std_last>
                                            <Name-std_first>Dudley</Name-std_first>
                                            <Name-std_initials>D.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Young</Name-std_last>
                                            <Name-std_first>Geneva</Name-std_first>
                                            <Name-std_initials>G.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Zainoun</Name-std_last>
                                            <Name-std_first>Joanne</Name-std_first>
                                            <Name-std_initials>J.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Zembek</Name-std_last>
                                            <Name-std_first>Lisa</Name-std_first>
                                            <Name-std_initials>L.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Zimmer</Name-std_last>
                                            <Name-std_first>Andrew</Name-std_first>
                                            <Name-std_initials>A.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Zody</Name-std_last>
                                            <Name-std_first>Michael</Name-std_first>
                                            <Name-std_initials>M.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                  <Author>
                                    <Author_name>
                                      <Person-id>
                                        <Person-id_name>
                                          <Name-std>
                                            <Name-std_last>Lander</Name-std_last>
                                            <Name-std_first>Eric</Name-std_first>
                                            <Name-std_initials>E.</Name-std_initials>
                                          </Name-std>
                                        </Person-id_name>
                                      </Person-id>
                                    </Author_name>
                                  </Author>
                                </Auth-list_names_std>
                              </Auth-list_names>
                              <Auth-list_affil>
                                <Affil>
                                  <Affil_std>
                                    <Affil_std_affil>Broad Institute</Affil_std_affil>
                                    <Affil_std_city>Cambridge</Affil_std_city>
                                    <Affil_std_sub>MA</Affil_std_sub>
                                    <Affil_std_country>USA</Affil_std_country>
                                    <Affil_std_street>320 Charles Street</Affil_std_street>
                                    <Affil_std_postal-code>02142</Affil_std_postal-code>
                                  </Affil_std>
                                </Affil>
                              </Auth-list_affil>
                            </Auth-list>
                          </Cit-sub_authors>
                          <Cit-sub_date>
                            <Date>
                              <Date_std>
                                <Date-std>
                                  <Date-std_year>2003</Date-std_year>
                                  <Date-std_month>4</Date-std_month>
                                  <Date-std_day>4</Date-std_day>
                                </Date-std>
                              </Date_std>
                            </Date>
                          </Cit-sub_date>
                        </Cit-sub>
                      </Pub_sub>
                    </Pub>
                  </Pub-equiv>
                </Pubdesc_pub>
              </Pubdesc>
            </Seqdesc_pub>
          </Seqdesc>
          <Seqdesc>
            <Seqdesc_update-date>
              <Date>
                <Date_std>
                  <Date-std>
                    <Date-std_year>2005</Date-std_year>
                    <Date-std_month>9</Date-std_month>
                    <Date-std_day>29</Date-std_day>
                  </Date-std>
                </Date_std>
              </Date>
            </Seqdesc_update-date>
          </Seqdesc>
        </Seq-descr>
      </Bioseq-set_descr>
      <Bioseq-set_seq-set>
        <Seq-entry>
          <Seq-entry_seq>
            <Bioseq>
              <Bioseq_id>
                <Seq-id>
                  <Seq-id_general>
                    <Dbtag>
                      <Dbtag_db>REF_MTRACK</Dbtag_db>
                      <Dbtag_tag>
                        <Object-id>
                          <Object-id_str>AN6253.2</Object-id_str>
                        </Object-id>
                      </Dbtag_tag>
                    </Dbtag>
                  </Seq-id_general>
                </Seq-id>
                <Seq-id>
                  <Seq-id_other>
                    <Textseq-id>
                      <Textseq-id_accession>XM_658765</Textseq-id_accession>
                      <Textseq-id_version>1</Textseq-id_version>
                    </Textseq-id>
                  </Seq-id_other>
                </Seq-id>
                <Seq-id>
                  <Seq-id_gi>67540165</Seq-id_gi>
                </Seq-id>
              </Bioseq_id>
              <Bioseq_descr>
                <Seq-descr>
                  <Seqdesc>
                    <Seqdesc_molinfo>
                      <MolInfo>
                        <MolInfo_biomol value="mRNA">3</MolInfo_biomol>
                        <MolInfo_completeness value="no-ends">5</MolInfo_completeness>
                      </MolInfo>
                    </Seqdesc_molinfo>
                  </Seqdesc>
                  <Seqdesc>
                    <Seqdesc_title>Aspergillus nidulans FGSC A4 hypothetical protein (AN6253.2), mRNA</Seqdesc_title>
                  </Seqdesc>
                  <Seqdesc>
                    <Seqdesc_user>
                      <User-object>
                        <User-object_type>
                          <Object-id>
                            <Object-id_str>RefGeneTracking</Object-id_str>
                          </Object-id>
                        </User-object_type>
                        <User-object_data>
                          <User-field>
                            <User-field_label>
                              <Object-id>
                                <Object-id_str>GenomicSource</Object-id_str>
                              </Object-id>
                            </User-field_label>
                            <User-field_data>
                              <User-field_data_str>NW_101348</User-field_data_str>
                            </User-field_data>
                          </User-field>
                          <User-field>
                            <User-field_label>
                              <Object-id>
                                <Object-id_str>Status</Object-id_str>
                              </Object-id>
                            </User-field_label>
                            <User-field_data>
                              <User-field_data_str>PROVISIONAL</User-field_data_str>
                            </User-field_data>
                          </User-field>
                        </User-object_data>
                      </User-object>
                    </Seqdesc_user>
                  </Seqdesc>
                  <Seqdesc>
                    <Seqdesc_genbank>
                      <GB-block>
                        <GB-block_extra-accessions>
                          <GB-block_extra-accessions_E>XM_410390</GB-block_extra-accessions_E>
                        </GB-block_extra-accessions>
                      </GB-block>
                    </Seqdesc_genbank>
                  </Seqdesc>
                  <Seqdesc>
                    <Seqdesc_create-date>
                      <Date>
                        <Date_std>
                          <Date-std>
                            <Date-std_year>2005</Date-std_year>
                            <Date-std_month>6</Date-std_month>
                            <Date-std_day>13</Date-std_day>
                          </Date-std>
                        </Date_std>
                      </Date>
                    </Seqdesc_create-date>
                  </Seqdesc>
                </Seq-descr>
              </Bioseq_descr>
              <Bioseq_inst>
                <Seq-inst>
                  <Seq-inst_repr value="raw"/>
                  <Seq-inst_mol value="rna"/>
                  <Seq-inst_length>1335</Seq-inst_length>
                  <Seq-inst_seq-data>
                    <Seq-data>
                      <Seq-data_iupacna>
                        <IUPACna>CTGACAGTGGGAGGCAAAGCGTATCCTATTGACGACTGGACGAACACTCCCGATACCATCCTCGCGCACATCGATCGCAGACTCTATCTCGATGATAGCCACCCTCTCGCGATCACTCGGAAGCTGATTGAGAGTCAATTTCCCCGCCCCGTCTACGGCAACTATTCTGAGAAGGACCCAATTGTGACGACTGCGCAGAATTTCGATGTCCTGGGTTTTCCCGCGGATCATCCCGGCCGGAGTCGCACAGACACATACTACCTTAACGAAAAGACGGTTCTTCGGACACACACAAGTGCCCATCAGCAGGCTTATTTCCAGCAGATCAGCCGCAATGAAGAAACTCGCCCGGAAGAAGTTGGGTACACTGTTGTTGCGGATGTCTATCGGAGAGATGCGATTGATCGTAGCCACTACCCGGTGTTCCATCAGATGGAAGGTGCTATGTTGTGGAAGCGCCCTGCCGACAAACCACTAGAGCACGCGAAACAAACTGCCGCCGCGATCATGAAGGACGTCTATAGCATTCCGTCTCATAGCGTACCTGTTGAAGACCCAAATCCTACTATCCATCCGCAGCGAAACCCGCTTCAGGCCGACTACCATAGCGAAGAGGAAGTCGAAGCCATCGCCGCGCACCTCAAGAGGTCTTTGGAGAGAATGGTGATCAAGGTTTTCAGCGAGGCACAAAAGGCTTCTGCGGCCTCCGAGGGCGCAGAGGCTGAGACTTTGAGGGTTCGGTGGGTCGAAGCATACTTCCCTTTCACCAGCCCATCGTGGGAGCTGGAGGTATTCTGGCAGGGCGACTGGCTTGAGATTCTGGGTTGTGGTGTGGTCAAGCAAGAGCTTCTTAACAACTCCGACGTGCCGAATCGCGTAGGCTGGGCGTTTGGTTTGGGCCTGGAGCGCATCGCCATGCTCCTCTTCAACATCCCCGATATTCGGTTGTTTTGGTCAAAAGACGAGCGGTTTCTCTCACAATTCAAGGCGGGCCAAATCACGCGCTTCGAGCCGTTCTCTAAGTACCCCGCTTGCTACAAGGACGTTGCTTTCTGGCTTCCTTCTGCTGCTACCAGCGGTGGAAGCGCAGCTGGCGGCGCGGTACCGGTTCATGAGAACGATATCATGGAGATTGTGCGTGGTGTTGGTGGCAATCTCGTTGAGGATGTCAAGCTGATTGACGAGTTCATCCACCCGAAGACTAACCGCAAAAGTTTGTGCTATCGGATCAACTATCGTAGCCTGGAACGAACGTTGACGAACGAGGAGACCAATGATCTCCATGACAAAGTGCGGCAGAAGCTTGTCAGCCAGCTTTGTGTCGAATTGCGATGA</IUPACna>
                      </Seq-data_iupacna>
                    </Seq-data>
                  </Seq-inst_seq-data>
                </Seq-inst>
              </Bioseq_inst>
              <Bioseq_annot>
                <Seq-annot>
                  <Seq-annot_data>
                    <Seq-annot_data_ftable>
                      <Seq-feat>
                        <Seq-feat_data>
                          <SeqFeatData>
                            <SeqFeatData_gene>
                              <Gene-ref>
                                <Gene-ref_locus-tag>AN6253.2</Gene-ref_locus-tag>
                              </Gene-ref>
                            </SeqFeatData_gene>
                          </SeqFeatData>
                        </Seq-feat_data>
                        <Seq-feat_partial value="true"/>
                        <Seq-feat_location>
                          <Seq-loc>
                            <Seq-loc_int>
                              <Seq-interval>
                                <Seq-interval_from>0</Seq-interval_from>
                                <Seq-interval_to>1334</Seq-interval_to>
                                <Seq-interval_strand>
                                  <Na-strand value="plus"/>
                                </Seq-interval_strand>
                                <Seq-interval_id>
                                  <Seq-id>
                                    <Seq-id_gi>67540165</Seq-id_gi>
                                  </Seq-id>
                                </Seq-interval_id>
                                <Seq-interval_fuzz-from>
                                  <Int-fuzz>
                                    <Int-fuzz_lim value="lt"/>
                                  </Int-fuzz>
                                </Seq-interval_fuzz-from>
                                <Seq-interval_fuzz-to>
                                  <Int-fuzz>
                                    <Int-fuzz_lim value="gt"/>
                                  </Int-fuzz>
                                </Seq-interval_fuzz-to>
                              </Seq-interval>
                            </Seq-loc_int>
                          </Seq-loc>
                        </Seq-feat_location>
                        <Seq-feat_dbxref>
                          <Dbtag>
                            <Dbtag_db>GeneID</Dbtag_db>
                            <Dbtag_tag>
                              <Object-id>
                                <Object-id_id>2871038</Object-id_id>
                              </Object-id>
                            </Dbtag_tag>
                          </Dbtag>
                        </Seq-feat_dbxref>
                      </Seq-feat>
                    </Seq-annot_data_ftable>
                  </Seq-annot_data>
                </Seq-annot>
              </Bioseq_annot>
            </Bioseq>
          </Seq-entry_seq>
        </Seq-entry>
        <Seq-entry>
          <Seq-entry_seq>
            <Bioseq>
              <Bioseq_id>
                <Seq-id>
                  <Seq-id_other>
                    <Textseq-id>
                      <Textseq-id_accession>XP_663857</Textseq-id_accession>
                      <Textseq-id_version>1</Textseq-id_version>
                    </Textseq-id>
                  </Seq-id_other>
                </Seq-id>
                <Seq-id>
                  <Seq-id_general>
                    <Dbtag>
                      <Dbtag_db>REF_WGS:AACD</Dbtag_db>
                      <Dbtag_tag>
                        <Object-id>
                          <Object-id_str>AN6253.2</Object-id_str>
                        </Object-id>
                      </Dbtag_tag>
                    </Dbtag>
                  </Seq-id_general>
                </Seq-id>
                <Seq-id>
                  <Seq-id_gi>67540166</Seq-id_gi>
                </Seq-id>
              </Bioseq_id>
              <Bioseq_descr>
                <Seq-descr>
                  <Seqdesc>
                    <Seqdesc_molinfo>
                      <MolInfo>
                        <MolInfo_biomol value="peptide">8</MolInfo_biomol>
                        <MolInfo_tech value="concept-trans">8</MolInfo_tech>
                      </MolInfo>
                    </Seqdesc_molinfo>
                  </Seqdesc>
                  <Seqdesc>
                    <Seqdesc_title>hypothetical protein AN6253.2 [Aspergillus nidulans FGSC A4]</Seqdesc_title>
                  </Seqdesc>
                  <Seqdesc>
                    <Seqdesc_user>
                      <User-object>
                        <User-object_type>
                          <Object-id>
                            <Object-id_str>RefGeneTracking</Object-id_str>
                          </Object-id>
                        </User-object_type>
                        <User-object_data>
                          <User-field>
                            <User-field_label>
                              <Object-id>
                                <Object-id_str>Assembly</Object-id_str>
                              </Object-id>
                            </User-field_label>
                            <User-field_data>
                              <User-field_data_fields>
                                <User-field>
                                  <User-field_label>
                                    <Object-id>
                                      <Object-id_id>0</Object-id_id>
                                    </Object-id>
                                  </User-field_label>
                                  <User-field_data>
                                    <User-field_data_fields>
                                      <User-field>
                                        <User-field_label>
                                          <Object-id>
                                            <Object-id_str>accession</Object-id_str>
                                          </Object-id>
                                        </User-field_label>
                                        <User-field_data>
                                          <User-field_data_str>EAA58637</User-field_data_str>
                                        </User-field_data>
                                      </User-field>
                                      <User-field>
                                        <User-field_label>
                                          <Object-id>
                                            <Object-id_str>gi</Object-id_str>
                                          </Object-id>
                                        </User-field_label>
                                        <User-field_data>
                                          <User-field_data_int>40739447</User-field_data_int>
                                        </User-field_data>
                                      </User-field>
                                    </User-field_data_fields>
                                  </User-field_data>
                                </User-field>
                              </User-field_data_fields>
                            </User-field_data>
                          </User-field>
                          <User-field>
                            <User-field_label>
                              <Object-id>
                                <Object-id_str>Status</Object-id_str>
                              </Object-id>
                            </User-field_label>
                            <User-field_data>
                              <User-field_data_str>PROVISIONAL</User-field_data_str>
                            </User-field_data>
                          </User-field>
                        </User-object_data>
                      </User-object>
                    </Seqdesc_user>
                  </Seqdesc>
                  <Seqdesc>
                    <Seqdesc_genbank>
                      <GB-block>
                        <GB-block_extra-accessions>
                          <GB-block_extra-accessions_E>XP_410390</GB-block_extra-accessions_E>
                        </GB-block_extra-accessions>
                      </GB-block>
                    </Seqdesc_genbank>
                  </Seqdesc>
                  <Seqdesc>
                    <Seqdesc_create-date>
                      <Date>
                        <Date_std>
                          <Date-std>
                            <Date-std_year>2005</Date-std_year>
                            <Date-std_month>6</Date-std_month>
                            <Date-std_day>13</Date-std_day>
                          </Date-std>
                        </Date_std>
                      </Date>
                    </Seqdesc_create-date>
                  </Seqdesc>
                </Seq-descr>
              </Bioseq_descr>
              <Bioseq_inst>
                <Seq-inst>
                  <Seq-inst_repr value="raw"/>
                  <Seq-inst_mol value="aa"/>
                  <Seq-inst_length>444</Seq-inst_length>
                  <Seq-inst_seq-data>
                    <Seq-data>
                      <Seq-data_iupacaa>
                        <IUPACaa>MTVGGKAYPIDDWTNTPDTILAHIDRRLYLDDSHPLAITRKLIESQFPRPVYGNYSEKDPIVTTAQNFDVLGFPADHPGRSRTDTYYLNEKTVLRTHTSAHQQAYFQQISRNEETRPEEVGYTVVADVYRRDAIDRSHYPVFHQMEGAMLWKRPADKPLEHAKQTAAAIMKDVYSIPSHSVPVEDPNPTIHPQRNPLQADYHSEEEVEAIAAHLKRSLERMVIKVFSEAQKASAASEGAEAETLRVRWVEAYFPFTSPSWELEVFWQGDWLEILGCGVVKQELLNNSDVPNRVGWAFGLGLERIAMLLFNIPDIRLFWSKDERFLSQFKAGQITRFEPFSKYPACYKDVAFWLPSAATSGGSAAGGAVPVHENDIMEIVRGVGGNLVEDVKLIDEFIHPKTNRKSLCYRINYRSLERTLTNEETNDLHDKVRQKLVSQLCVELR</IUPACaa>
                      </Seq-data_iupacaa>
                    </Seq-data>
                  </Seq-inst_seq-data>
                </Seq-inst>
              </Bioseq_inst>
              <Bioseq_annot>
                <Seq-annot>
                  <Seq-annot_data>
                    <Seq-annot_data_ftable>
                      <Seq-feat>
                        <Seq-feat_data>
                          <SeqFeatData>
                            <SeqFeatData_prot>
                              <Prot-ref>
                                <Prot-ref_name>
                                  <Prot-ref_name_E>hypothetical protein</Prot-ref_name_E>
                                </Prot-ref_name>
                                <Prot-ref_desc>similar to phenylalanyl-tRNA synthetase alpha subunit-like protein</Prot-ref_desc>
                              </Prot-ref>
                            </SeqFeatData_prot>
                          </SeqFeatData>
                        </Seq-feat_data>
                        <Seq-feat_location>
                          <Seq-loc>
                            <Seq-loc_int>
                              <Seq-interval>
                                <Seq-interval_from>0</Seq-interval_from>
                                <Seq-interval_to>443</Seq-interval_to>
                                <Seq-interval_strand>
                                  <Na-strand value="plus"/>
                                </Seq-interval_strand>
                                <Seq-interval_id>
                                  <Seq-id>
                                    <Seq-id_gi>67540166</Seq-id_gi>
                                  </Seq-id>
                                </Seq-interval_id>
                              </Seq-interval>
                            </Seq-loc_int>
                          </Seq-loc>
                        </Seq-feat_location>
                      </Seq-feat>
                    </Seq-annot_data_ftable>
                  </Seq-annot_data>
                </Seq-annot>
              </Bioseq_annot>
            </Bioseq>
          </Seq-entry_seq>
        </Seq-entry>
      </Bioseq-set_seq-set>
      <Bioseq-set_annot>
        <Seq-annot>
          <Seq-annot_data>
            <Seq-annot_data_ftable>
              <Seq-feat>
                <Seq-feat_data>
                  <SeqFeatData>
                    <SeqFeatData_cdregion>
                      <Cdregion>
                        <Cdregion_frame value="one"/>
                        <Cdregion_code>
                          <Genetic-code>
                            <Genetic-code_E>
                              <Genetic-code_E_id>1</Genetic-code_E_id>
                            </Genetic-code_E>
                          </Genetic-code>
                        </Cdregion_code>
                      </Cdregion>
                    </SeqFeatData_cdregion>
                  </SeqFeatData>
                </Seq-feat_data>
                <Seq-feat_product>
                  <Seq-loc>
                    <Seq-loc_whole>
                      <Seq-id>
                        <Seq-id_gi>67540166</Seq-id_gi>
                      </Seq-id>
                    </Seq-loc_whole>
                  </Seq-loc>
                </Seq-feat_product>
                <Seq-feat_location>
                  <Seq-loc>
                    <Seq-loc_int>
                      <Seq-interval>
                        <Seq-interval_from>0</Seq-interval_from>
                        <Seq-interval_to>1334</Seq-interval_to>
                        <Seq-interval_strand>
                          <Na-strand value="plus"/>
                        </Seq-interval_strand>
                        <Seq-interval_id>
                          <Seq-id>
                            <Seq-id_gi>67540165</Seq-id_gi>
                          </Seq-id>
                        </Seq-interval_id>
                      </Seq-interval>
                    </Seq-loc_int>
                  </Seq-loc>
                </Seq-feat_location>
              </Seq-feat>
            </Seq-annot_data_ftable>
          </Seq-annot_data>
        </Seq-annot>
      </Bioseq-set_annot>
    </Bioseq-set>
  </Seq-entry_set>
</Seq-entry>
</Bioseq-set_seq-set>
</Bioseq-set>

                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA