Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_658765               1335 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN6253.2), mRNA.
ACCESSION   XM_658765 XM_410390
VERSION     XM_658765.1  GI:67540165
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 1335)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1335)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101348).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1335
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="I"
     gene            <1..>1335
                     /locus_tag="AN6253.2"
                     /db_xref="GeneID:2871038"
     CDS             1..1335
                     /locus_tag="AN6253.2"
                     /note="similar to phenylalanyl-tRNA synthetase alpha
                     subunit-like protein"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_663857.1"
                     /db_xref="GI:67540166"
                     /db_xref="GeneID:2871038"
                     /translation="MTVGGKAYPIDDWTNTPDTILAHIDRRLYLDDSHPLAITRKLIE
                     SQFPRPVYGNYSEKDPIVTTAQNFDVLGFPADHPGRSRTDTYYLNEKTVLRTHTSAHQ
                     QAYFQQISRNEETRPEEVGYTVVADVYRRDAIDRSHYPVFHQMEGAMLWKRPADKPLE
                     HAKQTAAAIMKDVYSIPSHSVPVEDPNPTIHPQRNPLQADYHSEEEVEAIAAHLKRSL
                     ERMVIKVFSEAQKASAASEGAEAETLRVRWVEAYFPFTSPSWELEVFWQGDWLEILGC
                     GVVKQELLNNSDVPNRVGWAFGLGLERIAMLLFNIPDIRLFWSKDERFLSQFKAGQIT
                     RFEPFSKYPACYKDVAFWLPSAATSGGSAAGGAVPVHENDIMEIVRGVGGNLVEDVKL
                     IDEFIHPKTNRKSLCYRINYRSLERTLTNEETNDLHDKVRQKLVSQLCVELR"
ORIGIN      
        1 ctgacagtgg gaggcaaagc gtatcctatt gacgactgga cgaacactcc cgataccatc
       61 ctcgcgcaca tcgatcgcag actctatctc gatgatagcc accctctcgc gatcactcgg
      121 aagctgattg agagtcaatt tccccgcccc gtctacggca actattctga gaaggaccca
      181 attgtgacga ctgcgcagaa tttcgatgtc ctgggttttc ccgcggatca tcccggccgg
      241 agtcgcacag acacatacta ccttaacgaa aagacggttc ttcggacaca cacaagtgcc
      301 catcagcagg cttatttcca gcagatcagc cgcaatgaag aaactcgccc ggaagaagtt
      361 gggtacactg ttgttgcgga tgtctatcgg agagatgcga ttgatcgtag ccactacccg
      421 gtgttccatc agatggaagg tgctatgttg tggaagcgcc ctgccgacaa accactagag
      481 cacgcgaaac aaactgccgc cgcgatcatg aaggacgtct atagcattcc gtctcatagc
      541 gtacctgttg aagacccaaa tcctactatc catccgcagc gaaacccgct tcaggccgac
      601 taccatagcg aagaggaagt cgaagccatc gccgcgcacc tcaagaggtc tttggagaga
      661 atggtgatca aggttttcag cgaggcacaa aaggcttctg cggcctccga gggcgcagag
      721 gctgagactt tgagggttcg gtgggtcgaa gcatacttcc ctttcaccag cccatcgtgg
      781 gagctggagg tattctggca gggcgactgg cttgagattc tgggttgtgg tgtggtcaag
      841 caagagcttc ttaacaactc cgacgtgccg aatcgcgtag gctgggcgtt tggtttgggc
      901 ctggagcgca tcgccatgct cctcttcaac atccccgata ttcggttgtt ttggtcaaaa
      961 gacgagcggt ttctctcaca attcaaggcg ggccaaatca cgcgcttcga gccgttctct
     1021 aagtaccccg cttgctacaa ggacgttgct ttctggcttc cttctgctgc taccagcggt
     1081 ggaagcgcag ctggcggcgc ggtaccggtt catgagaacg atatcatgga gattgtgcgt
     1141 ggtgttggtg gcaatctcgt tgaggatgtc aagctgattg acgagttcat ccacccgaag
     1201 actaaccgca aaagtttgtg ctatcggatc aactatcgta gcctggaacg aacgttgacg
     1261 aacgaggaga ccaatgatct ccatgacaaa gtgcggcaga agcttgtcag ccagctttgt
     1321 gtcgaattgc gatga
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA