Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_658758                435 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN6246.2), mRNA.
ACCESSION   XM_658758 XM_410383
VERSION     XM_658758.1  GI:67540151
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 435)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 435)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101348).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..435
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="I"
     gene            1..435
                     /locus_tag="AN6246.2"
                     /db_xref="GeneID:2870834"
     CDS             1..435
                     /locus_tag="AN6246.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_663850.1"
                     /db_xref="GI:67540152"
                     /db_xref="GeneID:2870834"
                     /translation="MFFPGDSTKGAKLFETRCKQCHTVENGGGHKVGPNLHGLFGRKT
                     GQAEGYAYTDANKQADVTWDENSLFKYLENPKKFIPGTKMAFGGLKKTKERNDLITYV
                     TLLTTDRAHRLTGCTATSRRALLKSFAIRRDKPPPGDRRASG"
ORIGIN      
        1 ttgttttttc caggcgactc taccaagggt gctaagctct tcgagacccg ttgcaagcag
       61 tgccacactg tcgagaacgg cggcggccac aaggtcggcc ccaacctcca cggtctcttc
      121 ggccgtaaga ctggtcaggc tgagggctac gcctacaccg atgccaacaa gcaggccgac
      181 gtcacctggg acgagaactc tctgttcaag tacctcgaga accccaagaa gttcatcccc
      241 ggtaccaaga tggctttcgg tggtctcaag aagaccaagg agaggaacga tctcatcacg
      301 tatgtaacgc tgcttaccac ggatagggca cataggctaa caggatgcac agctacctca
      361 aggagagcac tgcttaaatc gttcgcgatt agacgagata aaccgccccc tggggatcgc
      421 cgggcctctg gctag
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA