Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_658181               1602 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN5669.2), mRNA.
ACCESSION   XM_658181 XM_409806
VERSION     XM_658181.1  GI:67538997
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 1602)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1602)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101339).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1602
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="V"
     gene            1..1602
                     /locus_tag="AN5669.2"
                     /db_xref="GeneID:2871961"
     CDS             1..1602
                     /locus_tag="AN5669.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_663273.1"
                     /db_xref="GI:67538998"
                     /db_xref="GeneID:2871961"
                     /translation="MASSFPSSAVCLHPQRYACASSGALRSIPARYDEPYSILLARAF
                     SNSVRRSEINKVVSSADLAIKDMKSNSTLLAGGFGLSGVPDTLINAVRNNPAITGLTA
                     VSNNAGVDGAGLGLLLQSKQIKKMIASYVGENKTFERMYLGGEIELELTPQGTLAERC
                     RAGGAGIPAFYTPAAFGTVVQTGELPLKHNPDGTVALYGQPRDVKVFDGKSYVMEEAI
                     KGDYAFVKAWKADKLGNCQFRYAAANFNGAMGRNAKMTIVEAEHIVEVGEIEPAAIHL
                     PGIYVKRVIQSTAPKNIEKYTFAKEEGEDTAAALGKGDTAAKRERIVRRAAKEFKNGM
                     YANLGIGMPMLAPNFVDPSVEVQLQSENGILGLGPYPKKGQEDADLINAGKETVTLAP
                     GAAVFGSDESFGMIRSGRIDLTILGAMQVSAKGDLANWMLPGKIKGFGGAMDLVSNPS
                     ATKVVVTMEHTDKKGNPKIVKQCEFPLTGRTCVSRIITELCVFDVDFVNGLTLIELAD
                     GVTVDEVRAKTEAPFKVADDLKPML"
ORIGIN      
        1 ttggcttcta gctttccttc gtctgcagta tgccttcacc cacagcgata tgcctgcgct
       61 tcgtcaggcg cgcttcgctc aatcccagca aggtatgacg aaccttattc tatcttgttg
      121 gcacgagcct tttccaacag cgttcgtcgc tctgagatta acaaagtggt ctcttctgca
      181 gacctcgcaa tcaaggacat gaagtcaaac tcaacgcttc tcgctggtgg gttcgggctt
      241 tccggtgtac cagacacatt gatcaatgcc gtgaggaaca accctgcaat cactggctta
      301 actgcggtga gcaataacgc cggcgttgat ggagctggtc tgggcctcct gctgcagtcg
      361 aagcagatca aaaagatgat cgccagttac gtgggcgaga ataagacctt tgagcgcatg
      421 tacttgggcg gcgagatcga gcttgagttg acgccgcagg gtaccttggc cgagcgctgt
      481 cgagcaggtg gtgcaggtat tccggccttc tatacgccag ctgcatttgg aaccgttgtc
      541 cagaccggcg aactgccgct caagcacaat cccgatggta ctgttgcatt gtacggccag
      601 ccccgcgatg tcaaggtctt tgatgggaag agttacgtaa tggaggaggc cattaagggt
      661 gactatgcct ttgtcaaggc ctggaaggcc gataagctcg gcaactgcca atttcgctac
      721 gcggctgcaa acttcaacgg cgccatgggt cgaaacgcga agatgacgat cgtagaggca
      781 gaacatatcg tcgaggtggg cgagatcgag cccgccgcta tccatctgcc gggtatctac
      841 gtcaagcgcg tcattcagag cacggcaccg aagaacatcg agaaatacac cttcgccaag
      901 gaggaaggtg aggataccgc cgcggcccta ggcaagggcg atacggctgc taagcgtgag
      961 cggatcgtcc gccgtgcggc taaagagttc aagaacggga tgtacgccaa cttgggcatt
     1021 ggcatgccca tgctcgcgcc taacttcgtc gacccctcag tggaagtgca gctgcagtct
     1081 gaaaacggta ttctgggctt aggcccttac ccaaagaagg gccaagagga cgcagacctc
     1141 atcaatgccg gaaaggagac cgtcactctt gcaccaggag ccgccgtctt tggcagcgat
     1201 gagtccttcg gcatgatccg gtctggccgg atcgacctga ctatcctcgg tgcgatgcaa
     1261 gtaagcgcca agggagacct cgctaactgg atgctcccgg gcaaaattaa aggttttggc
     1321 ggcgcaatgg acctcgtctc caacccttcc gcaacaaagg ttgtcgtgac tatggagcat
     1381 accgataaga agggcaaccc caagatcgtc aaacagtgcg aattccctct gacgggcagg
     1441 acttgcgtta gccgcatcat cactgaactc tgcgtgttcg atgtcgactt tgtcaacgga
     1501 ttgactctta ttgagttagc ggatggtgtc acagttgatg aggtccgggc taagactgag
     1561 gcgccgttca aggttgctga tgatctgaag cctatgctgt ga
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA