Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_658098               1056 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN5586.2), mRNA.
ACCESSION   XM_658098 XM_409723
VERSION     XM_658098.1  GI:67538831
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 1056)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1056)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101337).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1056
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="V"
     gene            1..1056
                     /locus_tag="AN5586.2"
                     /db_xref="GeneID:2871877"
     CDS             1..1056
                     /locus_tag="AN5586.2"
                     /note="similar to mannose-1-phosphate guanylyltransferase"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_663190.1"
                     /db_xref="GI:67538832"
                     /db_xref="GeneID:2871877"
                     /translation="MRPLTLTLPKPLVEFGNRPMILHQVESLAAAGVTDIVLAVNYRP
                     DVMVSALKKYEEQYNVKIEFSVETEPLGTAGPLKLAESILAKDDSPFFVLNSDVICDY
                     PFQQLAEFHKRHGDEGTIVVTKVDEPSKYGVVVHKPNHPSRIDRFVEKPVEFVGNRIN
                     AGMYILNPSVLKRIELRPTSIEQETFPAIVRDGQLHSFDLEGFWMDVGQPKDFLTGTC
                     LYLTSLTKRNSKLLAPNSEPYVYGGNVMVDPTAKIGKNCRIGPNVVIGPNVVIGDGVR
                     LQRCVLMENSKVKDHAWIKSTIVGWNSSVGRWARLENVTVLGDDVTIADEVYVNGGSI
                     LPHKSIKQNIDVPAIIM"
ORIGIN      
        1 ctgcggcctc taactctcac tcttcccaag ccgctcgtgg agtttggtaa tcgtcctatg
       61 attctgcacc aggttgagag cttagctgct gccggtgtca cggatattgt cctcgctgtc
      121 aactaccgcc cagatgtcat ggtttctgcg ctcaagaagt acgaagagca gtacaacgta
      181 aagatcgagt tctccgttga gaccgaaccc ctcggcaccg ctggtcccct taaactggca
      241 gagagtattc tcgctaaaga cgactctcca ttcttcgtcc tgaactcaga tgtcatctgt
      301 gactatcctt tccaacaatt ggccgagttt cacaagcgcc acggcgatga agggaccatc
      361 gtcgtcacaa aagtggatga gccatcaaaa tatggtgtcg ttgtgcacaa gcccaaccac
      421 ccctctcgca ttgaccggtt cgtcgagaag cccgtcgagt tcgtcggtaa ccgcatcaac
      481 gccggtatgt atatcctgaa tccgagcgtg ctgaagcgca ttgagttgcg ccccacctcc
      541 attgagcaag agaccttccc cgccatcgtg cgggacggcc agcttcactc atttgacctc
      601 gagggattct ggatggatgt tggtcagccc aaggatttcc ttaccggaac ctgtctttac
      661 ctcacttccc tcacaaagcg caactcgaag ctactcgccc caaactcgga gccttatgta
      721 tatggtggaa acgtcatggt cgaccctact gcgaagattg gaaagaactg ccgcatcggc
      781 cctaatgttg tcatcggacc gaacgtcgtg ataggtgacg gtgtccgtct gcagcggtgc
      841 gtactcatgg agaacagcaa ggtcaaggac catgcctgga tcaaatcaac catcgtggga
      901 tggaacagct ccgtcggccg gtgggcccgt ctggaaaatg tgacggttct tggtgacgat
      961 gtgacgattg ccgacgaagt ctacgtcaac ggcggctcga tcctgccaca caagagcatc
     1021 aagcagaaca ttgatgttcc tgcaatcatc atgtaa
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA