Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_657299                228 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 60S ribosomal protein L37 (AN4787.2),
            mRNA.
ACCESSION   XM_657299 XM_408924
VERSION     XM_657299.1  GI:67537233
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 228)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 228)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101322).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..228
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="III"
     gene            1..228
                     /locus_tag="AN4787.2"
                     /db_xref="GeneID:2872582"
     CDS             1..228
                     /locus_tag="AN4787.2"
                     /codon_start=1
                     /product="60S ribosomal protein L37"
                     /protein_id="XP_662391.1"
                     /db_xref="GI:67537234"
                     /db_xref="GeneID:2872582"
                     /translation="MCRRCGRRSYHIQKSTCANCGYPAAKTRKYNWSEKAKRRKTTGS
                     GRTAHLRDVHRRFKNGFQVGTPKGARGPENH"
ORIGIN      
        1 ctgtgccggc gttgtggccg ccggtcctac cacatccaga agtcgacctg cgcaaactgc
       61 ggttaccccg ctgctaagac tcgcaagtac aactggagcg agaaggccaa gcgacgcaag
      121 accaccggtt ccggccgtac cgctcacctg cgggacgtcc accgccgctt caagaacggc
      181 ttccaggttg gcactcccaa gggcgcccgt ggtcctgaga accactaa
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA