Home   In News   Download   Search   Browse   Statistics   References   Contact Us   Help
About nonAUG
 
Save to File
 
Feedback
LOCUS       XM_656528                396 bp    mRNA    linear   PLN 29-SEP-2005
DEFINITION  Aspergillus nidulans FGSC A4 hypothetical protein (AN4016.2), mRNA.
ACCESSION   XM_656528 XM_408153
VERSION     XM_656528.1  GI:67527199
KEYWORDS    .
SOURCE      Aspergillus nidulans FGSC A4
  ORGANISM  Aspergillus nidulans FGSC A4
            Eukaryota; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes;
            Eurotiales; Trichocomaceae; Emericella.
REFERENCE   1  (bases 1 to 396)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Genome Sequence of Aspergillus nidulans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 396)
  AUTHORS   Birren,B., Nusbaum,C., Abouelleil,A., Allen,N., Anderson,S.,
            Arachchi,H.M., Barna,N., Bastien,V., Bloom,T., Boguslavkiy,L.,
            Boukhgalter,B., Butler,J., Calvo,S.E., Camarata,J., Chang,J.,
            Choepel,Y., Collymore,A., Cook,A., Cooke,P., Corum,B.,
            DeArellano,K., Diaz,J.S., Dodge,S., Dooley,K., Dorris,L.,
            Elkins,T., Engels,R., Erickson,J., Faro,S., Ferreira,P.,
            FitzGerald,M., Gage,D., Galagan,J., Gardyna,S., Gnerre,S.,
            Graham,L., Grand-Pierre,N., Hafez,N., Hagopian,D., Hagos,B.,
            Hall,J., Horton,L., Hulme,W., Iliev,I., Jaffe,D., Johnson,R.,
            Jones,C., Kamal,M., Kamat,A., Karatas,A., Kells,C., Landers,T.,
            Levine,R., Lindblad-Toh,K., Liu,G., Lui,A., Ma,L.-J., Mabbitt,R.,
            MacLean,C., Macdonald,P., Major,J., Manning,J., Matthews,C.,
            Mauceli,E., McCarthy,M., Meldrim,J., Meneus,L., Mihova,T.,
            Mlenga,V., Murphy,T., Naylor,J., Nguyen,C., Nicol,R., Nielsen,C.B.,
            Norbu,C., O'Connor,T., O'Donnell,P., O'Neil,D., Oliver,J.,
            Peterson,K., Phunkhang,P., Pierre,N., Purcell,S., Rachupka,A.,
            Ramasamy,U., Raymond,C., Retta,R., Rise,C., Rogov,P., Roman,J.,
            Schauer,S., Schupback,R., Seaman,S., Severy,P., Smirnov,S.,
            Smith,C., Spencer,B., Stange-Thomann,N., Stojanovic,N., Stubbs,M.,
            Talamas,J., Tesfaye,S., Theodore,J., Topham,K., Travers,M.,
            Vassiliev,H., Venkataraman,V.S., Viel,R., Vo,A., Wang,S.,
            Wilson,B., Wu,X., Wyman,D., Young,G., Zainoun,J., Zembek,L.,
            Zimmer,A., Zody,M. and Lander,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2003) Broad Institute, 320 Charles Street,
            Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_101306).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..396
                     /organism="Aspergillus nidulans FGSC A4"
                     /mol_type="mRNA"
                     /strain="FGSC A4"
                     /db_xref="taxon:227321"
                     /chromosome="II"
     gene            1..396
                     /locus_tag="AN4016.2"
                     /db_xref="GeneID:2873434"
     CDS             1..396
                     /locus_tag="AN4016.2"
                     /note="similar to ubiquitin fusion protein"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_661620.1"
                     /db_xref="GI:67527200"
                     /db_xref="GeneID:2873434"
                     /translation="MFFSNSFVKTLTGKTITLDVESSDTIDNVKTKIQDKEGIPPDQQ
                     RLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKNICRKC
                     YARLPPRATNCRKRKCGHSNQLRPKKKLK"
ORIGIN      
        1 ctgttcttct cgaatagttt cgtcaagacc ctcacgggta agaccattac ccttgacgtc
       61 gagtccagcg acaccatcga caacgtcaag accaagatcc aggacaagga gggtatcccc
      121 ccggatcagc agcgtctcat cttcgctgga aagcagcttg aggatggccg taccctgagc
      181 gattacaaca tccagaagga gtccactctc cacctcgtcc tccgtcttcg tggtggtatc
      241 atcgagccgt cgctcaaggc cctcgcttcc aagtacaact gcgagaagaa catctgccgc
      301 aagtgctacg ctcgtctccc tccccgtgct accaactgcc gtaagaggaa gtgcggtcac
      361 tccaaccagt tgcgccccaa gaagaagctc aaataa
//


                  

Copyright (c) 2009 All rights reserved, IIT Kanpur.                   Copyright   | Privacy  |  Disclaimer   |  Accessibility

Laboratory of Computational Biology
Department of Biological Sciences and Bioengineering

Indian Institute of Technology Kanpur -208016
INDIA