MIPModDB
 
STRUCTURE BASED ALIGNMENT
  A conserved positions at helix-helix interface     A Ar/R selectivity filter

Protein
Helix 1
Helix 2
1J4N
FWRAVVAEFLAMILFIFISIGSALGF
DNVKVSLAFGLSIATLAQSVGH
1FX8
LKGQCIAEFLGTGLLIFFGVGCVAAL
GQWEISVIWGLGVAMAIYLTAG
1RC2
MFRKLAAECFGTFWLVFGGCGSAVLA
GFAGVALAFGLTVLTMAFAVGH
1Z98
FWRAAIAEFIATLLFLYITVATVIGH
GLLGIAWAFGGMIFVLVYCTAG
2B60
FWRAIFAEFFATLFYVFFGLGASLRW
HVLQVALAFGLALATLVQAVGH
2F2B
LTKRCIAEFIGTFILVFFGAGSAAVT
DWVAIGLAFGFAIAASIYALGN
SEITAL1265FIQKIIAEIFGTYFLIFAGCGAVTINTFPGVAIVWGLAVMVMVYAVGH
SEITAL1266LYRAAIAEFVATLLFLYITVATVIGYGILGIAWAFGGMIFILVYCTAG
SEITAL1267ALRSYLAEFISTFLFVFATAGSAISASLVATAVAQAFALFVAVFIAAD
SEITAL1268SIKAYVAEFIATLLFVFAGVGSAIAYGLVAIAIAHALALFVGVSVAAN
SEITAL1269FYRAGIAEFVATFLFLYITILTVMGVGIQGIAWSFGGMIFALVYCTAG
SEITAL1270LLKKVVSEVVSTFLLVFVTCGAAAISSQLGQSVAGGLIVTVMIYAVGH
SEITAL1271FYRAGIAEFVATFLFLYISILTVMGVGIQGIAWSFGGMIFALVYCTAG
SEITAL1272LYRAVIAEFIATLLFLYITVLTVIGYGILGIAWAFGGMIFVLVYCTAG
SEITAL1273LYRAVIAEFVATLLFLYITVATVIGYGILGIAWAFGGMIFILVYCTAG
SEITAL1274LYRAVIAEFVATLLFLYITVATVIGYGILGIAWAFGGMIFILVYCTAG
SEITAL1275LYRALIAEFVATLIFLYVSIATVIGYGFLGVAWSFGATIFILVYCIGG
SEITAL1276FVQKIIAEIFGTYFLIFAGCAAVAVNTFPGICIVWGLAVMVMVYSVGH
SEITAL1277CVRAVLAELVLTFLFVFTVVSAAMAAALAAVAITNALAAGVLVTAGFH
SEITAL1278ALRAAAADAVVTFLWVLCVSTLGASTLLITVSLVSVLLFVFNILCDA-
SEITAL1279FYRAGIAEFVATFLFLYVTVLAVMGVGVQGIAWAFGGMIFALVYCTAG
SEITAL1280LGKKVISEVVATFLLVFVTCGAASIYSQLGQSVAGGLIVTVMIYATGH
SEITAL1281SLKAYVAEFISTLVFVFAGVGSAIAYGLVAVAVCHGFGLFVAVAIGAN
SEITAL1282YIQQLIAEFLATFFLIFAGCGVITVNTFPGIAVVWGMTVMAMVYAVGH
SEITAL1283FFRGVLGELVLTFLFVFIQVGAAMTINLTAVALGQALAVCVIATAGFH
SEITAL1284FFRGVLGELVLTFLFVFIQVGAAMTINLTAVALGQALAVCVIATAGFH
SEITAL1285FFRGVLGELVLTFLFVFIQVGAAMTADLTAVALGQALVVCVIATAGFH
SEITAL1286CVRAVLAELILTFLFVFAGVGSAMATGLTAVALAHTLVVAVMISAGLH
SEITAL1287--MAYVAEFIATLLFVFAGVGSAITYGLVAIAFTHALALFVGVSVAAN
SEITAL1288--MAYVAEFIATLLFVFAGVGSAITYGLVAIAFTHALALFVGVSVAAN
SEITAL1289TAKAAVAEFISMLIFVFAGSGSGMAFGLIAAALAHALALFVAVAVGAN
SEITAL1290FIRELMVEGMASFLLVFWSGVAALMQSFPMVCLVVALTVGFVLCWLG-
SEITAL1291LVKKVVAEFLGTFLLIFILLSALIMNGLLGVAAVAGSAVLVIVASLVH
SEITAL1292LIKKVVAEFLGTFILIFTVLSTIIMNSLLGIATSAGLAVTVLVLSLIH
SEITAL1293LVKKVAAEFIGTFILMFTVVSAIVADGVLGIAAAAGLAVVAVVLAVVD
SEITAL1294LIKKVAAELLGTFLLVFTVLSALITDGLPGVAAAAGMAIVVLVSSLAH
SEITAL1295LIKKVIAEFLGTFILNITVLSTIIMNSLLGIATSAGLAVTILVLSLIH
SEITAL1296LYRAVIAEFVATLLFLYITVATVIGYGILGIAWAFGGMIFILVYCTAG
SEITAL1297SLKAYVAEFIATLLFVFAGVGSAIAYGLVAIAIAHAFALFVGVSMAAN
SEITAL1298FYRAGIAEFVATFLFLYISILTVMGVGIQGIAWSFGGMIFALVYCTAG
SEITAL1299ATRAAVAEFVATGIFVFAAEGSVYGLGLVAVAIAHALALAAAVAVASN
SEITAL1300SLRSYFAEFISTFLFVFAAVGSAISASLVATAVAQAFGLFAAVLIAAD
SEITAL1301AARGAAADAVVTFLWVLCASALGATTALLVTASLLAALLFAFDLLCGA
SEITAL1302LTRKLGAEFMGTFILIFFATAAPIVNSPFGNAACAGLAVTIIILSTGH
SEITAL1303TIRAAISEFLATAIFVFAAEGSVLSLGLVAVALAHALALSVAVAVAVN
SEITAL1304ALKAAFAEFISTLIFVFAGQGSGMAFGLIAAAIAHAFALFVAVSVGAN
SEITAL1305TLRDAAAELLATAVFVFAAEGATLSFGLVAVALAHALALAAAVACTLN
SEITAL1306LYRAAIAEFVATLLFLYLTVATVIGYGVLGIAWAFGGMIFLLVYCAAG

Protein
Helix 3
Helix 4
1J4N
SVLRAIMYIIAQCVGAIVATAILSG
SGQGLGIEIIGTLQLVLCVLATT
1FX8
DKRKVIPFIVSQVAGAFCAAALVYG
FVQAFAVEMVITAILMGLILALT
1RC2
PAKEVVGYVIAQVVGGIVAAALLYL
MLSALVVELVLSAGFLLVIHGAT
1Z98
SLLRALVYMIAQCLGAICGVGLVKA
KGTALGAEIIGTFVLVYTVFSAT
2B60
SLLRAICYVVAQLLGAVAGAAVLYS
VGQATIVEIFLTLQFVLCIFATY
2F2B
PGREVVPYIIAQLLGAAFGSFIFLQ
YWQAMLAEVVGTFLLMITIMGIA
SEITAL1265PWRQLPAYVLAQMLGATLASGTLRLDVQSLVLEIITTFYLMFVISGVA
SEITAL1266SLVRAVLYIIAQCLGAICGVGLVKGKGTGLAAEIIGTFVLVYTVFSAT
SEITAL1267AVLPAVLYCAAQLLGATFACLVVHIGFGASVLEAAATFMVVYTVHAAC
SEITAL1268TILTGLFYWVAQLLGASVACLLLKF--EGVVFEIIITFALVYTVYATA
SEITAL1269SLTRAIFYIIMQCLGAICGAGVVKGKGSGLGAEIVGTFVLVYTVFSAT
SEITAL1270PWIQVPFYWAAQFTGAICASFVLKA--HALVIEVIVTFNMMFVTLAVA
SEITAL1271SLTRALFYMVMQCLGAICGAGVVKGKGDGLGAEIVGTFVLVYTVFSAT
SEITAL1272SLVRALLYIVAQCLGAICGVGLVKARGTGLGAEIIGTFVLVYTVFSAT
SEITAL1273SLVRAVLYMAAQCLGAICGVALVKGTGTGLAAEIIGTFVLVYTVFSAT
SEITAL1274SLVRAILYMAAQCLGAICGVALVKGTGTGLAAEIVGTFVLVYTVFSAT
SEITAL1275SLLRTVLYIVAQCLGAICGVAIVKGVVAGLGAEIMGTFVLVYTVFSAT
SEITAL1276PWRQVPAYAAAQVMGSTAASLTLRLDVQSLVIELIISFNLMFVVSGVA
SEITAL1277SKLRTVLYVAAQLLASSLACILLRYPMQGLVMEVILTFSLLFVTYAMI
SEITAL1278SLFAVALRFPAQAAGAVCGALAISE---GAVAELVLTFVITMAVLWII
SEITAL1279SLPRAGYYAVMQCLGAACGAGVVKAKGDGLGAEIVGTFVLVYTVFSAT
SEITAL1280PWIQVPFYWAAQFTGAMCAAFVLKA--HALVIEIVVTFNMMFVTCAVA
SEITAL1281TILTGLFYWIAQLLGAIVGAVLVQYALEGVVMEIIVTFGLVYTVYATA
SEITAL1282PWRKVPAYMVVQTVAATFASLLLRQSSQSLVLEFIITFYLMFVIMAVA
SEITAL1283TLFRSALYIVAQMLGSSTACVLLRWPIQGVVAEVVFTFSLLFVIYATI
SEITAL1284TLFRSALYIVAQMLGSSTACVLLRWPIQGVVAEVVFTFSLLFVIYATI
SEITAL1285TLFRSALYIVAQMLGSSTACILLRWPIQGVVAEAVFTFSLLFVIYATI
SEITAL1286TLFRSALYVVAQLLGSVAACLLLAFTLQGVLMEVVLTFSLLFAVYATV
SEITAL1287TILTGLFYWVAQLLGASVACLLLKF--EGVVFEIIITFALLYTVYATA
SEITAL1288TILTGLFYWVAQLLGASVACLLLKF--EGVVFEIIITFALLYTVYATA
SEITAL1289TLLKAVVYWVAQLLGSVVACLLLKI--NAVVFEIVMTFGLVYTVYATA
SEITAL1290SWAKLPFYVMVQLAGSVLACLSVNGTRLPFLLELLASAVLMIVIATAA
SEITAL1291PRAHLLPYVAAQLLGSTTASFAAKAAGEALVVEFFTTFVLLFVITALS
SEITAL1292PLAHLLPYVTAQILGSIAASFSVKG--EAFFLEFITTFVLLFIITALA
SEITAL1293PRAHVAPYAAAQTLGSAAATFLAKGVAEAFFVELALTFVLVFVIAAVA
SEITAL1294PRPHLAPYVAAQLLGSTAASFAAKAGAEAFAVEFATTFVFLFVVTALA
SEITAL1295PLAHLLPYMTAQILGSITASFTVKG--EAFFFYFIMIFVLLLLITALA
SEITAL1296SLVRALLYIVAQCLGAICGVGLVKGKGTGLAAEIIGTFVLVYTVFSAT
SEITAL1297TILTGIFYWVAQLLGASVACLLLKFEVEGVVMEIVITFALVYTVYATA
SEITAL1298SLTRAVFYMIMQCLGAICGAGVVKGKGDGLGAEIVGTFILVYTVFSAT
SEITAL1299FGRAVVYYWAAKLLGAVAAAFLLMLERHALLLEAVMTFGLVYAVYATA
SEITAL1300GVPSAIFYWASQMLGSTFACLVLHYGFGAAIIEGVLTFMLVYTVHVAG
SEITAL1301SLFSVALRFPAQAAGAVGGALAISE---GAVAEGVLTFVITLAVLWII
SEITAL1302PWLQVPAYVSVQVLGSICASFALKGTAQAFFTEFIITFNLLFVVTAVA
SEITAL1303SLVRAVFYWVAQLLGAIAASLLLRLDWHAVLLEAAMTFGLMYAYYATV
SEITAL1304TLFRGILYWIAQLLGSTVACFLLRFVWEALVLEIVMTFGLVYTVYATA
SEITAL1305CLVRSLVYWAAQLIGAVTAALLLRLGWHAVVLEAAMAFGLMYAYCATA
SEITAL1306SVPRAALYVAAQCLGAVCGAGLVRARGTGLAAEVVGTFVLVYTVFSAT

Protein
Helix 5
Helix 6
1J4N
SGPLAIGFSVALGHLLAID
WIFWVGPFIGAALAVLIYDFI
1FX8
LAPLLIGLLIAVIGASMGP
LVPLFGPIVGAIVGAFAYRKL
1RC2
FAPIAIGLALTLIHLISIP
WFFWVVPIVGGIIGGLIYRTL
1Z98
LAPLPIGFAVFMVHLATIP
WIFWVGPFIGAAVAAAYHQYV
2B60
SVALAVGFSLTLGHLFGMY
WVYWVGPVIGAGLGSLLYDFL
2F2B
FAGIIIGLTVAGIITTLGN
SIYVIGPIVGAVLAALTYQYL
SEITAL1265LAGLAVGATILLNVLIAGPWVYVVGPVVGAVAGAWAYNLI
SEITAL1266LAPLPIGFAVFMVHLATIPWIFWVGPLIGAAIAAAYHQYV
SEITAL1267TGSLAIGLVTGACALATGSAVYWAGPMVGAALAAIVHQHV
SEITAL1268IAPIAIGFIVGANILAAGPWVYWVGPLIGGGLAGLIYGDV
SEITAL1269LAPLPIGFAVFLVHLATIPWIFWVGPFIGAALAAIYHQVI
SEITAL1270LAGLAVGSAVCITSIFAGAWIYFLGPVLGTLSGAWTYTYI
SEITAL1271LAPLPIGFAVFLVHLATIPWIFWVGPFIGAALAAIYHVVI
SEITAL1272LAPLPIGFAVFMVHLATIPWIFWVGPFAGAAIAAFYHQYI
SEITAL1273LAPLPIGFAVFMVHLATIPWIFWVGPFIGAAIAALYHQIV
SEITAL1274LAPLPIGFAVFMVHLATIPWIFWVGPFIGAAIAALYHQIV
SEITAL1275LVPLPIGFAVFVVHLATIPWIFWVGPLIGATAAALYHKLV
SEITAL1276LAGLAIGATVLLNVLFAGPWVYFAGPILGTVAGAWAYNLI
SEITAL1277IGPLLTGLIVGANSLAGGNWVYWLGPLLGGSLAAVVYESL
SEITAL1278VKTLMISISTVCLVLSGAAYVYWISPFIGAVLAAWIFKAL
SEITAL1279LAPLPIGLAVFLVHLATIPWIFWVGPFTGAALAAVYHQVV
SEITAL1280LAGLAVGSAVCITSIFAGPWIYFLGPVIGTLSGAWVYTYI
SEITAL1281IAPIAIGFIVGANILVAGPWIYWVGPLVGGGLAGIVYRYI
SEITAL1282MAGLAVGGTIMLNALFAGPWVYIFGPFAGAAAGAWAYNLI
SEITAL1283VGPLLTGLLVGANSIAGAVWVYWVGPLAGGPLAVVVYECL
SEITAL1284VGPLLTGLLVGANSIAGAVWVYWVGPLAGGPLAVVVYECL
SEITAL1285AGPLLTGLLVGANSIAGAVWVYWVGPLAGGPLAVVVYECF
SEITAL1286MGPLLVGLVVGANVLAGGPWVYWVGPLIGGPLAGLVYDGL
SEITAL1287IAPISIGFIVGANILAAGPWVYWVGPLIGGGLAGLIYGDV
SEITAL1288IAPISIGFIVGANILAAGPWVYWVGPLIGGGLAGLIYGDV
SEITAL1289IAPIAIGFIVGANILAGGAWVYWLGPFVGAAIAALVYDII
SEITAL1290AGGLAIGAAVGTLGLIIGPWIYLVAPVAGMLLGALCNRAV
SEITAL1291LIAVGAGAAVMMSALISGEWVYMVAPPLGAIAGTGAYIAL
SEITAL1292LIAVAVGATIMMNALVAGPWIYMVATPLGAVAGTGAYVAI
SEITAL1293AVAVSIAAAITMNALVGASWVYLVAPPLGAIAGAGTYTLI
SEITAL1294MVAVGAGAAVVMSALVSGKWVYMVAPPLGAIAGSGAYHAL
SEITAL1295AVAVGAEVMMNALVAGMPSWMYMVATPLGAIAGTGACVAI
SEITAL1296LAPLPIGFAVFMVHLATIPWIFWVGPFIGAAIAAAYHQYV
SEITAL1297IAPMAIGFIVGANILAAGPWVYWVGPLIGGGLAGLVYGDV
SEITAL1298LAPLPIGFAVFLVHLATIPWIFWVGPFIGAALAAIYHQVV
SEITAL1299-HRSRVGFVLGANILAGGPWVYWVGPLIGAGLAGALYEFV
SEITAL1300LGALAVGLVAGALVLSAGPAVYWAGPMIGAAVAALAHQIL
SEITAL1301LKTMLLSVSIVSLILAGAEYVYWICPFIGAMLAGWVFRAV
SEITAL1302LAGIAVGAAVTLNILVAGPWIYLLAPTLGAVAGAGVYTAV
SEITAL1303IGPLAVGFLLGANVLAGGPWVYWLGPFLGAGVAGLVYEYL
SEITAL1304IAPIAIGFIVGANILVGGAWVYWVGPLIGGGLAGVIYEVL
SEITAL1305VAPLAVGLLAGANVLACGAWVYWAGPMVGAGLSGFFYEHL
SEITAL1306LAPLPIGFAVFVVHLATIPWIFWVGPLTGAAMATLYHEHV

Protein
Loop B
Loop E
1J4N
AHLNPAVTLGLLLS
GCGINPARSFGSSVIT
1FX8
AHLNPAVTIALWLF
GFAMNPARDFGPKVFA
1RC2
GHFNPAVTIGLWAG
NTSVNPARSTAVAI-F
1Z98
GHINPAVTFGLFLA
GTGINPARSFGAAVIF
2B60
AHVNPAVTFAFLVG
GAGMNPARSFAPAILT
2F2B
CHINPAVTIGLWSV
GSSLNPARTFGPYLND
SEITAL1265AHFNPAVTFAFATCGASMNPARSVGPALVS
SEITAL1266GHINPAVTFGLFLAGTGINPARSLGAAVIY
SEITAL1267GHANPAVTFAFAICGASMNPARSFGPAVVS
SEITAL1268GHLNPAVTFGLAVGGGSMNPARSFGPAVAA
SEITAL1269GHINPAVTFGLFLAGTGINPARSLGAAIIY
SEITAL1270AHMNPAVTLAFAVFGGSMNPARTLGPALAS
SEITAL1271GHINPAVTFGLFLAGTGINPARSLGAAIVY
SEITAL1272GHINPAVTFGLFLAGTGINPARSLGAAVIY
SEITAL1273GHINPAVTFGLFLAGTGINPARSLGAAVVY
SEITAL1274GHINPAVTFGLFLAGTGINPARSLGAAVVY
SEITAL1275GHINPAVTFGLFVGGTGINPARSLGAAVIF
SEITAL1276AHLNPAVSVAFATCGASMNPARTLGPAIVA
SEITAL1277GHLNPAVTVAMMVRGASMNPARSFGPALAT
SEITAL1278ASFNPTGIAAFYAAGPSMNPANAFGWAYVN
SEITAL1279GHINPAVTFGLLLAGTGINPARSLGAAIIY
SEITAL1280AHMNPAVTLSFACFGGSMNPARTLAPAVAS
SEITAL1281GHVNPAVTFGLALGGGSMNPARSFGPAVAS
SEITAL1282AHINPAVTVGFAVSGASMNPVRSIGPALVG
SEITAL1283GHVNPAVTLSMAVGGASMNPARSFGPALAT
SEITAL1284GHVNPAVTLSMAVGGASMNPARSFGPALAT
SEITAL1285GHVNPAVTLSLAVGGASMNPARSFGPAVAT
SEITAL1286GHINPAVTLGLAVTGASMNPARSFGPALAA
SEITAL1287GHLNPAVTFGLAVGGGSVNPARSFDPAVAA
SEITAL1288GHLNPAVTFGLAVGGGSVNPARSFDPAVAA
SEITAL1289GHVNPAVTFGAFVGGASMNPAVSFGPAVVS
SEITAL1290AHFNPAVTATFAAFGGSMNPIRTLGPAIVL
SEITAL1291AHLNPAVSVAMAAFGASMNPARTLGPAIAA
SEITAL1292CHLNPAVSIAMTVFGASMNPARTLGPAIAT
SEITAL1293SHLNPAVSIAMAAFGPSMNPARTIGAAVAT
SEITAL1294GHMNPAVSAAMAAFGASMNPARTLGPAIAT
SEITAL1295CHLKPAVSIAMSAFASMMNPARSIGPAITT
SEITAL1296GHINPAVTLGLFLAGTGINPARSLGAAVIY
SEITAL1297GHLNPAVTFGLAVGGGSMNPARSFGPAVAA
SEITAL1298GHINPAVTFGLFLAGTGINPARSLGAAVIY
SEITAL1299GHVNPAVTFGVLVGGAAMNPALVGWSW---
SEITAL1300GHANPAVTFAFAIGGASMNPARSFGPAVVS
SEITAL1301ASFNPTDFAASYAAGPSMNPANAFGWAYVN
SEITAL1302AHLNPSLTIAFAALGGSMNPVRTLGPAVAA
SEITAL1303GHVNPAITFGALIGGAGMNPARVFGPALVG
SEITAL1304GHVNPAVTFGAFVGGASMNPAVSFGPALVS
SEITAL1305GHVNPAITFGAFLGGAVMNPARAFGPAIVG
SEITAL1306GHINPAVTLALLQAGTGINPARSFGAAVVY
 
 
Last Updated:
Best Viewed at 1024X768 resolution on IE 5.0+, Firefox 2.0+

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering,
Indian Institute of Technology, Kanpur, INDIA-208016
Copyright (c) 2007 All rights reserved, IIT Kanpur