MIPModDB
 
STRUCTURE BASED ALIGNMENT
  A conserved positions at helix-helix interface     A Ar/R selectivity filter

Protein
Helix 1
Helix 2
1J4N
FWRAVVAEFLAMILFIFISIGSALGF
DNVKVSLAFGLSIATLAQSVGH
1FX8
LKGQCIAEFLGTGLLIFFGVGCVAAL
GQWEISVIWGLGVAMAIYLTAG
1RC2
MFRKLAAECFGTFWLVFGGCGSAVLA
GFAGVALAFGLTVLTMAFAVGH
1Z98
FWRAAIAEFIATLLFLYITVATVIGH
GLLGIAWAFGGMIFVLVYCTAG
2B60
FWRAIFAEFFATLFYVFFGLGASLRW
HVLQVALAFGLALATLVQAVGH
2F2B
LTKRCIAEFIGTFILVFFGAGSAAVT
DWVAIGLAFGFAIAASIYALGN
BOFUCK1453WIREMAAEAMGVFFFVYPGIASCASFSVFQIGWAFAIGIAFAIITCGS
BOFUCK1552HIVAVIGELIGTTLFLFFGYAGIEVAVLFYISATFGASLMVTAWIFFR

Protein
Helix 3
Helix 4
1J4N
SVLRAIMYIIAQCVGAIVATAILSG
SGQGLGIEIIGTLQLVLCVLATT
1FX8
DKRKVIPFIVSQVAGAFCAAALVYG
FVQAFAVEMVITAILMGLILALT
1RC2
PAKEVVGYVIAQVVGGIVAAALLYL
MLSALVVELVLSAGFLLVIHGAT
1Z98
SLLRALVYMIAQCLGAICGVGLVKA
KGTALGAEIIGTFVLVYTVFSAT
2B60
SLLRAICYVVAQLLGAVAGAAVLYS
VGQATIVEIFLTLQFVLCIFATY
2F2B
PGREVVPYIIAQLLGAAFGSFIFLQ
YWQAMLAEVVGTFLLMITIMGIA
BOFUCK1453PWKKVPQYIFAQVFGSFMAAMLLVGYGYLFFIEFFADVFVGIVIWACL
BOFUCK1552SPIRAFLLVITQLGASCLAAILVQEMGQGFVIEAITTAALIFTIIMLA

Protein
Helix 5
Helix 6
1J4N
SGPLAIGFSVALGHLLAID
WIFWVGPFIGAALAVLIYDFI
1FX8
LAPLLIGLLIAVIGASMGP
LVPLFGPIVGAIVGAFAYRKL
1RC2
FAPIAIGLALTLIHLISIP
WFFWVVPIVGGIIGGLIYRTL
1Z98
LAPLPIGFAVFMVHLATIP
WIFWVGPFIGAAVAAAYHQYV
2B60
SVALAVGFSLTLGHLFGMY
WVYWVGPVIGAGLGSLLYDFL
2F2B
FAGIIIGLTVAGIITTLGN
SIYVIGPIVGAVLAALTYQYL
BOFUCK1453AVPWVIGLGYATMIWGFADLIPVLTSIPAMLFGTALYEMI
BOFUCK1552VAPIGIGLALFVAHMVAVPWIYWVGPILGAGLAVLFFRLI

Protein
Loop B
Loop E
1J4N
AHLNPAVTLGLLLS
GCGINPARSFGSSVIT
1FX8
AHLNPAVTIALWLF
GFAMNPARDFGPKVFA
1RC2
GHFNPAVTIGLWAG
NTSVNPARSTAVAI-F
1Z98
GHINPAVTFGLFLA
GTGINPARSFGAAVIF
2B60
AHVNPAVTFAFLVG
GAGMNPARSFAPAILT
2F2B
CHINPAVTIGLWSV
GSSLNPARTFGPYLND
BOFUCK1453GHFNAAVTISCAVW-IELNSSRDLGARIVA
BOFUCK1552GLFNPAVTLALAILGASLNPARSFGPSAIV
 
 
Last Updated:
Best Viewed at 1024X768 resolution on IE 5.0+, Firefox 2.0+

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering,
Indian Institute of Technology, Kanpur, INDIA-208016
Copyright (c) 2007 All rights reserved, IIT Kanpur